SecReT6
Protein ID: 83717589
SecReT6 ID111
T6SS typei3
Gene symbol-
Locus tagBTH_II0123
StrainBurkholderia thailandensis E264
Repliconchromosome II [GenBank: NC_007650] [Browse all T6SS(s) in this replicon]
Location [Strand]142705..143187 [+]
Producthypothetical protein
NoteTssD
UniProt IDQ2T924
KEGG IDbte:BTH_II0123
PDB IDNA
Domain hit(s) vs Pfam DUF796 [PF05638], Evalue: 2.40E-40, Aligned region: 6..136
Protein Sequence: 160 a.a.     [Download]
>gi|83717589|ref|YP_438325.1| unnamed protein product [Burkholderia thailandensis E264]
MSHDIFLKINGIDGEAEDATHKGEIEVLSWSWNVSQQSNMHLGSGGGAGKATVDDLLFEHYIDRASPNLV
QYCLLGKHIDEARLVVRKAGGSPLEYIKLTMNDVLVTQVSPAGVAQDESRPRELVRLSFSRLKQEYVVQN
AQGGSGGAITATFDIKKNAA
 
Nucleotide Sequence: 483 bp     [Download]
>gi|83716035|ref|NC_007650.1|:142705-143187 Burkholderia thailandensis E264 chromosome II, complete sequence
ATGTCGCACGACATTTTCCTCAAGATCAACGGTATCGATGGCGAGGCGGAAGACGCAACCCACAAGGGCG
AAATCGAGGTCTTGAGCTGGTCGTGGAACGTCAGTCAGCAATCGAACATGCACCTGGGTTCGGGTGGTGG
CGCGGGCAAGGCGACGGTCGACGATCTGCTGTTCGAACATTACATCGATCGTGCCAGCCCGAATCTCGTT
CAATACTGCTTGCTCGGCAAGCATATCGACGAGGCCCGTCTCGTGGTGCGCAAGGCGGGCGGCAGCCCGC
TCGAATACATCAAGCTCACGATGAACGACGTGCTCGTTACCCAGGTGAGCCCGGCCGGCGTCGCTCAGGA
CGAGTCGCGTCCGCGTGAGCTCGTTCGGCTGTCGTTCTCGCGCCTGAAGCAGGAGTATGTCGTCCAGAAC
GCACAGGGCGGCAGCGGCGGCGCAATCACCGCGACTTTCGACATCAAGAAGAACGCGGCGTAA