SecReT6
Protein ID: 83717629
SecReT6 ID111
T6SS typei3
Gene symbol-
Locus tagBTH_II0124
StrainBurkholderia thailandensis E264
Repliconchromosome II [GenBank: NC_007650] [Browse all T6SS(s) in this replicon]
Location [Strand]143315..143857 [+]
Productlipoprotein
NoteTssJ
UniProt IDQ2T923
KEGG IDbte:BTH_II0124
PDB IDNA
Domain hit(s) vs Pfam T6SS-SciN [PF12790], Evalue: 1.40E-37, Aligned region: 26..174
Protein Sequence: 180 a.a.     [Download]
>gi|83717629|ref|YP_438326.1| unnamed protein product [Burkholderia thailandensis E264]
MVSQFFFRREAARRTAVKRIVAAMVCASLAACASLPARKETADLIVKIKVSEGANPDEHERPAPVMVRLY
ELKSAGAFENADFFTLQSDSRKVLGDDAIATDEFVMRPGDTRDIHRRADSAATSIGVLVGYRALGKSVWR
AVHKLPPVPEDAWYRAFTPRTKIKLNVDVGQQTVSITELE
 
Nucleotide Sequence: 543 bp     [Download]
>gi|83716035|ref|NC_007650.1|:143315-143857 Burkholderia thailandensis E264 chromosome II, complete sequence
ATGGTTTCCCAATTTTTCTTTCGCCGCGAAGCGGCCAGGCGAACCGCGGTCAAGCGGATCGTGGCGGCAA
TGGTATGCGCGTCGCTCGCGGCGTGCGCAAGCTTGCCGGCACGCAAGGAAACAGCCGATCTGATCGTGAA
GATCAAGGTGAGCGAAGGCGCGAACCCGGATGAGCATGAACGCCCGGCGCCCGTGATGGTGCGGCTGTAC
GAGCTGAAATCGGCCGGCGCGTTCGAGAACGCCGATTTTTTCACGCTGCAGAGCGACAGCCGGAAGGTGT
TGGGTGACGACGCGATCGCGACGGATGAATTCGTGATGCGTCCGGGCGACACCCGAGATATTCACCGGCG
CGCCGATTCCGCGGCCACGTCGATCGGCGTGCTGGTGGGCTATCGGGCGCTCGGCAAATCGGTGTGGCGG
GCGGTGCATAAGCTGCCGCCGGTTCCCGAAGATGCATGGTACCGGGCATTCACGCCAAGGACGAAGATCA
AGTTGAACGTCGATGTCGGGCAGCAAACCGTGTCGATTACAGAATTGGAATGA