SecReT6
Protein ID: 83717683
SecReT6 ID112
T6SS typei3
Gene symbol-
Locus tagBTH_II0258
StrainBurkholderia thailandensis E264
Repliconchromosome II [GenBank: NC_007650] [Browse all T6SS(s) in this replicon]
Location [Strand]317322..317903 [+]
Producthypothetical protein
NoteTssB
UniProt IDQ2T8N9
KEGG IDbte:BTH_II0258
PDB IDNA
Domain hit(s) vs Pfam DUF770 [PF05591], Evalue: 2.20E-58, Aligned region: 15..166
Protein Sequence: 193 a.a.     [Download]
>gi|83717683|ref|YP_438460.1| unnamed protein product [Burkholderia thailandensis E264]
MTSKYKASASGQKFIARNRAPRVQIEYDVETYGAERRVQLPFVMGVIADLAGKRAEPLPDLPERKFLEVD
VDNFDERMKSIAPRVAFQVPNTLSGDGMLSVDMTFESIDDFSPAAIARNVDALRRLLEARTELSNLLSYM
DGKHGAEQLIENAINDPELLKTLVRQPLAASADGGAPAVADTGTADDSEIRHE
 
Nucleotide Sequence: 582 bp     [Download]
>gi|83716035|ref|NC_007650.1|:317322-317903 Burkholderia thailandensis E264 chromosome II, complete sequence
ATGACGAGCAAGTACAAGGCTTCGGCCAGCGGACAGAAATTCATTGCGCGCAACCGCGCGCCGCGCGTGC
AGATCGAGTACGACGTCGAGACTTACGGCGCCGAGCGCCGCGTCCAACTGCCGTTCGTGATGGGCGTGAT
CGCCGATCTCGCGGGCAAGCGGGCCGAGCCGCTGCCGGACCTGCCGGAGCGCAAGTTCCTCGAAGTCGAC
GTCGACAACTTCGACGAGCGGATGAAGTCGATCGCGCCGCGCGTCGCGTTCCAGGTGCCGAACACGCTGT
CGGGCGACGGGATGCTGAGCGTCGACATGACGTTCGAGAGCATCGACGATTTCTCGCCCGCCGCGATCGC
GCGCAACGTCGATGCGCTGCGGCGCCTGCTGGAGGCGCGCACCGAGCTGTCGAACCTGCTGTCGTACATG
GACGGCAAGCACGGCGCCGAGCAGTTGATCGAAAACGCGATCAACGATCCGGAACTGCTGAAGACCCTCG
TGCGGCAGCCGCTCGCGGCGAGCGCCGACGGCGGCGCGCCGGCCGTCGCCGATACCGGCACCGCGGACGA
TTCGGAGATTCGCCATGAATGA