SecReT6
Protein ID: 83717751
SecReT6 ID114
T6SS typei3
Gene symbol-
Locus tagBTH_II1895
StrainBurkholderia thailandensis E264
Repliconchromosome II [GenBank: NC_007650] [Browse all T6SS(s) in this replicon]
Location [Strand]2298643..2301486 [-]
ProductATP-dependent Clp protease, ATP-binding subunit ClpB
NoteTssH
UniProt IDQ2T410
KEGG IDbte:BTH_II1895
PDB IDNA
Domain hit(s) vs Pfam AAA_2 [PF07724], Evalue: 5.10E-35, Aligned region: 227..249
AAA_2 [PF07724], Evalue: 5.10E-35, Aligned region: 597..763
AAA [PF00004], Evalue: 1.20E-16, Aligned region: 228..333
AAA [PF00004], Evalue: 1.20E-16, Aligned region: 602..687
AAA_5 [PF07728], Evalue: 1.30E-11, Aligned region: 228..248
AAA_5 [PF07728], Evalue: 1.30E-11, Aligned region: 602..707
AAA_16 [PF13191], Evalue: 4.10E-10, Aligned region: 205..250
AAA_16 [PF13191], Evalue: 4.10E-10, Aligned region: 271..306
AAA_16 [PF13191], Evalue: 4.10E-10, Aligned region: 490..490
AAA_16 [PF13191], Evalue: 4.10E-10, Aligned region: 596..625
AAA_16 [PF13191], Evalue: 4.10E-10, Aligned region: 618..696
AAA_16 [PF13191], Evalue: 4.10E-10, Aligned region: 767..821
AAA_22 [PF13401], Evalue: 7.70E-08, Aligned region: 228..341
AAA_22 [PF13401], Evalue: 7.70E-08, Aligned region: 600..623
AAA_22 [PF13401], Evalue: 7.70E-08, Aligned region: 662..686
Clp_N [PF02861], Evalue: 1.20E-07, Aligned region: 23..72
Clp_N [PF02861], Evalue: 1.20E-07, Aligned region: 111..129
ClpB_D2-small [PF10431], Evalue: 3.50E-07, Aligned region: 769..842
ClpB_D2-small [PF10431], Evalue: 3.50E-07, Aligned region: 850..867
Sigma54_activat [PF00158], Evalue: 2.00E-06, Aligned region: 207..249
Sigma54_activat [PF00158], Evalue: 2.00E-06, Aligned region: 602..702
Zeta_toxin [PF06414], Evalue: 4.70E-06, Aligned region: 222..252
Zeta_toxin [PF06414], Evalue: 4.70E-06, Aligned region: 601..652
AAA_17 [PF13207], Evalue: 4.90E-06, Aligned region: 11..50
AAA_17 [PF13207], Evalue: 4.90E-06, Aligned region: 228..248
AAA_17 [PF13207], Evalue: 4.90E-06, Aligned region: 453..453
AAA_17 [PF13207], Evalue: 4.90E-06, Aligned region: 603..637
AAA_19 [PF13245], Evalue: 1.70E-05, Aligned region: 225..249
AAA_19 [PF13245], Evalue: 1.70E-05, Aligned region: 600..623
AAA_19 [PF13245], Evalue: 1.70E-05, Aligned region: 833..850
NACHT [PF05729], Evalue: 2.50E-05, Aligned region: 228..256
NACHT [PF05729], Evalue: 2.50E-05, Aligned region: 601..633
AAA_18 [PF13238], Evalue: 6.60E-05, Aligned region: 228..248
AAA_18 [PF13238], Evalue: 6.60E-05, Aligned region: 603..628
IstB_IS21 [PF01695], Evalue: 0.00016, Aligned region: 222..247
IstB_IS21 [PF01695], Evalue: 0.00016, Aligned region: 602..620
IstB_IS21 [PF01695], Evalue: 0.00016, Aligned region: 715..745
SRP54 [PF00448], Evalue: 0.00017, Aligned region: 228..260
SRP54 [PF00448], Evalue: 0.00017, Aligned region: 601..624
AAA_29 [PF13555], Evalue: 0.00018, Aligned region: 222..245
AAA_29 [PF13555], Evalue: 0.00018, Aligned region: 600..634
AAA_25 [PF13481], Evalue: 0.00044, Aligned region: 228..251
AAA_25 [PF13481], Evalue: 0.00044, Aligned region: 597..620
AAA_33 [PF13671], Evalue: 0.00047, Aligned region: 15..35
AAA_33 [PF13671], Evalue: 0.00047, Aligned region: 118..149
AAA_33 [PF13671], Evalue: 0.00047, Aligned region: 228..299
AAA_33 [PF13671], Evalue: 0.00047, Aligned region: 601..622
AAA_30 [PF13604], Evalue: 0.00063, Aligned region: 227..263
AAA_30 [PF13604], Evalue: 0.00063, Aligned region: 601..623
Torsin [PF06309], Evalue: 0.00078, Aligned region: 230..249
Torsin [PF06309], Evalue: 0.00078, Aligned region: 558..624
Arch_ATPase [PF01637], Evalue: 0.0008, Aligned region: 206..247
Arch_ATPase [PF01637], Evalue: 0.0008, Aligned region: 280..377
Arch_ATPase [PF01637], Evalue: 0.0008, Aligned region: 601..635
RNA_helicase [PF00910], Evalue: 0.0021, Aligned region: 229..249
RNA_helicase [PF00910], Evalue: 0.0021, Aligned region: 603..623
DUF815 [PF05673], Evalue: 0.0097, Aligned region: 218..252
DUF815 [PF05673], Evalue: 0.0097, Aligned region: 602..617
Protein Sequence: 947 a.a.     [Download]
>gi|83717751|ref|YP_440089.1| unnamed protein product [Burkholderia thailandensis E264]
MNRERIFNCLGRTTYAALVDATALGRSRRHAFIDLDHWALCLLQREQSDLARLFEQFGSDVGEAKRRMEK
ALDGFDVSGDSLRDISSSLERSVGPAVIWSQIAARAGKVRSGHLLLAWLDEDLTRRWLQQRVPNGITSVA
LDEVVKRYEALAPGWTETDEAPAALDGGALGAEAGEAGADGTSDALAKWATCVTEQAARGELDPVVGRDD
ELRTVIDILSRRRQNNPILVGEAGVGKTAVVEALAQKIHAGAVPPGLIGAQVWALDLARMQAGAGVRGEF
EQRLKSLIDAVIASAAPIILFCDETHTLIGAGGAAGTGDAANLIKPMLARGQLRMVAATTWSEYKQYIEP
DAALVRRFQAVPVDEPSDDAAVDMLRTIAPRFAAHHGVRIVDSALRGAVELSRRYLPARQLPDKAISLLD
TACARVAMSQNCAPAELERLQHQAFAIGQTLDWRASDRRMGVRTPGDEAELEGRQASLVQQAATLETVVD
AQRDEVRSWLARLNDETHVSADSDGDSFAARIGANRWVRPWVDEHVVSEVLAEWTGVPVAQLAQDDAQRV
VELEGALNAGIHGQTGAMRSIAQALQVSHSGLNDPRRPLGVMLLAGPTGTGKSQAAAKLAELLFGGERNL
LQFNMNEFQEAHTVSTLKGAPPGYVGYGKGGRLTEAVRKKPYSVLLLDEFDRAHPDIHEVFYQVFDQGWM
EDGEGRRISFRNCLILLTSNLGDVEIEAACKADPQISQAKLDKLVGERLQGRFSPALLARIQLVAFRPLD
VDALTGIATQALDELGERLAENDLQWRADEGVASWVAHAVSQHPANGRAVRDLLRQHVMPAVARGVLAAR
AEGRALKTVRLSAHEKLSLVFDEDALEIGGTDAASLGEQAEAAAREAAASAAAHGAPEAHDAPESRDVHE
ANGDMRAEADDERPADAHHPDETTSANAGTTGEPSCV
 
Nucleotide Sequence: 2844 bp     [Download]
>gi|83716035|ref|NC_007650.1|:c2301486-2298643 Burkholderia thailandensis E264 chromosome II, complete sequence
GTGAATCGCGAACGCATATTCAACTGTCTCGGCCGCACGACCTATGCGGCCCTTGTCGATGCGACGGCGC
TAGGCCGATCCCGTCGGCATGCCTTCATCGATCTCGATCACTGGGCACTGTGCCTGCTGCAGCGCGAGCA
GAGCGATCTCGCGCGGCTGTTCGAGCAGTTCGGCAGCGATGTCGGCGAAGCGAAGCGCCGGATGGAGAAG
GCGCTGGACGGCTTCGACGTGAGCGGCGACTCGCTGCGCGACATCTCCAGCTCGCTCGAGCGCAGCGTCG
GGCCGGCCGTCATCTGGAGCCAGATCGCGGCGCGCGCGGGCAAGGTGCGCTCCGGCCACCTGTTGCTCGC
GTGGCTCGACGAGGATCTGACGCGCCGCTGGTTGCAGCAGCGCGTGCCGAACGGCATCACGTCGGTCGCG
CTCGACGAGGTGGTGAAGCGCTATGAGGCGCTCGCGCCCGGCTGGACGGAAACCGACGAAGCGCCCGCGG
CGCTCGACGGCGGCGCGCTTGGCGCGGAAGCGGGCGAGGCCGGCGCCGACGGCACGAGCGACGCGCTCGC
GAAATGGGCGACGTGCGTGACCGAGCAGGCCGCGCGCGGCGAGCTCGATCCCGTGGTCGGCCGCGACGAT
GAATTGCGCACGGTGATCGACATCCTGTCGCGCCGCCGCCAGAACAACCCGATTCTCGTCGGCGAGGCAG
GCGTGGGCAAGACGGCCGTCGTCGAGGCGCTCGCGCAGAAGATCCACGCGGGCGCGGTGCCGCCGGGCCT
CATCGGCGCGCAGGTGTGGGCGCTCGATCTGGCGCGGATGCAGGCGGGCGCGGGCGTGCGCGGCGAGTTC
GAGCAGCGCCTGAAATCGCTGATCGACGCGGTGATCGCGTCGGCCGCGCCGATCATCCTGTTCTGCGACG
AGACGCATACGCTGATCGGCGCGGGCGGCGCGGCCGGCACGGGCGACGCGGCGAACCTGATCAAGCCGAT
GCTCGCGCGCGGCCAGTTGCGGATGGTCGCCGCGACGACGTGGTCCGAATACAAGCAGTACATCGAGCCG
GATGCGGCGCTCGTGCGGCGCTTCCAGGCTGTTCCGGTCGACGAGCCGAGCGACGACGCGGCGGTCGACA
TGCTGCGCACGATCGCGCCGCGCTTCGCGGCGCACCACGGCGTGCGGATCGTGGATTCGGCGCTGCGCGG
CGCGGTCGAGCTGTCGCGCCGCTATCTGCCCGCGCGGCAGTTGCCGGACAAGGCGATCAGCCTGCTCGAC
ACCGCGTGCGCGCGCGTCGCGATGAGTCAGAACTGCGCGCCCGCCGAGCTCGAGCGCTTGCAGCATCAGG
CGTTCGCGATCGGCCAGACGCTCGATTGGCGTGCGAGCGACCGCCGCATGGGCGTGCGCACGCCGGGCGA
CGAAGCCGAGCTCGAGGGCCGCCAGGCGAGCCTCGTCCAGCAGGCGGCCACGCTCGAGACGGTCGTCGAC
GCGCAGCGCGACGAAGTGCGTTCGTGGCTCGCGCGTCTGAACGACGAGACGCATGTGTCTGCCGACAGCG
ACGGCGATTCGTTCGCCGCGCGCATCGGCGCGAATCGCTGGGTGCGGCCGTGGGTCGACGAGCACGTCGT
GTCGGAGGTGCTCGCCGAGTGGACGGGCGTGCCCGTCGCGCAGCTCGCGCAGGACGACGCGCAGCGCGTG
GTCGAGCTCGAGGGGGCGCTCAATGCGGGCATCCACGGGCAGACGGGCGCGATGCGCTCGATCGCGCAGG
CGCTGCAGGTGTCGCATTCGGGGCTCAACGATCCGCGCCGGCCGCTCGGCGTGATGCTGCTCGCCGGCCC
GACCGGCACCGGCAAGAGCCAGGCCGCGGCGAAGCTCGCCGAGCTGCTGTTCGGCGGCGAGCGCAACCTG
CTGCAGTTCAACATGAACGAGTTTCAGGAAGCGCACACGGTGTCGACGCTCAAGGGCGCGCCGCCCGGAT
ACGTCGGTTACGGCAAGGGCGGGCGCTTGACCGAGGCGGTTCGCAAGAAGCCGTACAGCGTGCTGCTGCT
CGACGAATTCGACCGCGCGCATCCGGACATTCATGAGGTGTTCTATCAAGTCTTCGATCAGGGCTGGATG
GAGGATGGCGAGGGCCGTCGGATCAGCTTCCGCAACTGCCTGATCCTGTTGACGAGCAATCTCGGCGACG
TCGAGATCGAAGCGGCGTGCAAGGCCGATCCGCAGATTTCGCAGGCGAAGCTCGACAAGCTCGTCGGCGA
ACGGCTGCAGGGGCGCTTCTCGCCCGCGCTGCTCGCGCGGATTCAGCTCGTCGCGTTCCGTCCGCTCGAC
GTCGACGCGCTGACCGGCATCGCGACGCAGGCGCTCGACGAACTCGGCGAGCGCCTCGCGGAGAACGATC
TGCAATGGCGCGCGGACGAAGGCGTCGCGTCGTGGGTCGCGCACGCGGTGTCGCAGCATCCGGCGAACGG
GCGCGCGGTGCGCGACCTGCTGCGCCAGCACGTGATGCCGGCCGTCGCGCGCGGCGTGCTCGCCGCGCGG
GCCGAAGGGCGCGCGCTGAAGACCGTGCGGCTGTCCGCGCACGAGAAGCTGTCGCTCGTGTTCGACGAGG
ATGCGCTGGAGATCGGCGGCACCGATGCGGCCTCGCTCGGCGAGCAGGCGGAGGCGGCGGCGCGCGAGGC
TGCGGCGTCCGCTGCGGCGCACGGCGCACCCGAAGCGCATGACGCACCTGAGTCGCGTGACGTGCATGAA
GCGAACGGCGACATGCGTGCCGAAGCGGACGACGAACGTCCGGCCGATGCGCATCATCCCGACGAAACGA
CCTCGGCGAACGCCGGCACGACGGGAGAACCGTCATGCGTCTGA