SecReT6
Protein ID: 83717753
SecReT6 ID114
T6SS typei3
Gene symbol-
Locus tagBTH_II1901
StrainBurkholderia thailandensis E264
Repliconchromosome II [GenBank: NC_007650] [Browse all T6SS(s) in this replicon]
Location [Strand]2307040..2307591 [-]
Producthypothetical protein
NoteTssB
UniProt IDQ2T404
KEGG IDbte:BTH_II1901
PDB IDNA
Domain hit(s) vs Pfam DUF770 [PF05591], Evalue: 4.50E-55, Aligned region: 11..161
Protein Sequence: 183 a.a.     [Download]
>gi|83717753|ref|YP_440095.1| unnamed protein product [Burkholderia thailandensis E264]
MVRQKDGQKFIGESRAPRVQIEYDVEVYGSQKKVELPFVAGVMADLSGDNTEPLGPVEDRRFQEVDVENF
DERMAQIAPSLSYHVKNVLTNDGTLIPIDLTFTSMESFEPAAVVKRIPELSTLLEARNRLKELLTYMDGK
AAAEDVIQELLKSPQWANEADAAPEQSGGAGEGADHQPEEGAK
 
Nucleotide Sequence: 552 bp     [Download]
>gi|83716035|ref|NC_007650.1|:c2307591-2307040 Burkholderia thailandensis E264 chromosome II, complete sequence
ATGGTTCGACAAAAGGATGGACAGAAATTCATCGGGGAGAGTCGTGCGCCCCGCGTGCAGATTGAATACG
ACGTCGAGGTGTACGGATCGCAGAAGAAGGTCGAACTGCCGTTCGTCGCGGGCGTGATGGCGGACCTGTC
GGGCGACAACACCGAGCCGCTCGGCCCCGTCGAGGATCGCCGCTTCCAGGAGGTCGACGTCGAGAACTTC
GACGAGCGGATGGCGCAGATCGCGCCGTCGCTCAGCTATCACGTGAAGAACGTGCTCACCAACGACGGCA
CGCTGATTCCGATCGATCTCACGTTTACGTCGATGGAATCGTTCGAGCCCGCGGCTGTCGTCAAGCGCAT
TCCCGAGCTATCGACGCTGCTCGAGGCGCGCAACCGTCTGAAGGAATTGCTGACCTACATGGACGGCAAG
GCGGCGGCCGAGGACGTGATTCAGGAATTGCTGAAGAGCCCGCAGTGGGCAAACGAGGCCGACGCGGCGC
CGGAGCAATCCGGCGGTGCCGGTGAAGGCGCAGACCACCAACCGGAAGAGGGTGCGAAATGA