SecReT6
Protein ID: 83717862
SecReT6 ID112
T6SS typei3
Gene symbol-
Locus tagBTH_II0257
StrainBurkholderia thailandensis E264
Repliconchromosome II [GenBank: NC_007650] [Browse all T6SS(s) in this replicon]
Location [Strand]316196..317260 [+]
ProductImpA-like N-terminal family protein
NoteTssA
UniProt IDQ2T8P0
KEGG IDbte:BTH_II0257
PDB IDNA
Domain hit(s) vs Pfam ImpA-rel_N [PF06812], Evalue: 9.30E-23, Aligned region: 56..116
ImpA-rel_N [PF06812], Evalue: 9.30E-23, Aligned region: 185..204
Protein Sequence: 354 a.a.     [Download]
>gi|83717862|ref|YP_438459.1| unnamed protein product [Burkholderia thailandensis E264]
MQSSDLIESLLAGVALDAPCGANLEYEQDFLRLQESATPRPEQQYGDTVIPAEAPDWGAVERLALELTAR
TKDLRVAAHLARSWTELRGIPGYADGLKLVAGMLGRWWDDVHPRLDADGDRDPAPRANALAEIAGAHGCA
RAARRQALFDGGPSVRDAERVFDGRDGGEHGYPGGRERLIADLVRARDGGQPALQAALAALDALDAIRAR
VASALGGEWAPDTSDFEKALRRIVRDGLPPPVAATETDARAGAANGAANAAHGGAANGAASGGTPAFAAN
GRAWRDAEVTSRDDVQFGLEKMCRYFELHEPSHPAPILLRRAQRLLSLDFYEIIRDLAPESLPKLDLLSG
QRSE
 
Nucleotide Sequence: 1065 bp     [Download]
>gi|83716035|ref|NC_007650.1|:316196-317260 Burkholderia thailandensis E264 chromosome II, complete sequence
ATGCAGAGTTCAGACCTGATCGAATCGTTGCTCGCCGGCGTCGCGCTCGACGCGCCGTGCGGCGCGAATC
TCGAATACGAGCAGGATTTCCTGCGGCTGCAGGAAAGCGCGACGCCGCGGCCCGAGCAGCAGTACGGCGA
CACCGTGATCCCGGCCGAGGCGCCGGACTGGGGCGCGGTCGAGCGTCTCGCGCTCGAGCTGACGGCGCGC
ACGAAGGATCTGCGCGTGGCCGCGCATCTCGCGCGCAGTTGGACCGAGCTGCGCGGCATTCCCGGTTATG
CGGACGGGTTGAAGCTCGTCGCGGGGATGCTGGGCCGGTGGTGGGACGACGTGCATCCGCGCCTGGACGC
CGACGGCGACCGCGACCCCGCGCCGCGCGCGAACGCGCTCGCCGAAATCGCGGGCGCGCACGGCTGCGCG
CGCGCCGCGCGCCGGCAGGCGCTCTTCGACGGCGGGCCGAGCGTGCGCGACGCCGAGCGCGTGTTCGACG
GCCGCGACGGCGGCGAGCACGGCTATCCGGGCGGCCGCGAGCGGCTGATCGCCGATCTGGTTCGCGCGCG
CGACGGCGGGCAGCCGGCGTTGCAGGCGGCGCTCGCCGCGCTCGACGCGCTCGATGCGATTCGCGCGCGC
GTCGCCTCGGCGCTCGGCGGCGAATGGGCGCCGGACACGAGCGACTTCGAGAAGGCGCTGCGCCGGATCG
TGCGCGACGGGCTGCCGCCGCCCGTGGCCGCGACCGAGACCGATGCGCGGGCGGGCGCGGCGAACGGCGC
GGCGAACGCGGCGCATGGCGGTGCCGCGAACGGCGCGGCTTCGGGCGGCACGCCGGCTTTCGCCGCGAAC
GGCCGCGCGTGGCGCGACGCCGAGGTGACGAGCCGCGACGATGTGCAGTTCGGCCTCGAAAAGATGTGCC
GCTACTTCGAGCTGCACGAGCCGAGCCATCCCGCGCCGATCCTGCTGCGCCGCGCGCAGCGGCTGCTGTC
GCTCGACTTTTACGAAATCATCCGGGATCTCGCGCCGGAGAGCCTGCCGAAGCTCGACTTGCTGAGCGGC
CAGCGCAGCGAATGA