SecReT6
Protein ID: 83717896
SecReT6 ID112
T6SS typei3
Gene symbol-
Locus tagBTH_II0264
StrainBurkholderia thailandensis E264
Repliconchromosome II [GenBank: NC_007650] [Browse all T6SS(s) in this replicon]
Location [Strand]323701..326358 [+]
ProductClpA/B type protease
NoteTssH
UniProt IDQ2T8N3
KEGG IDbte:BTH_II0264
PDB IDNA
Domain hit(s) vs Pfam AAA_2 [PF07724], Evalue: 1.40E-38, Aligned region: 225..244
AAA_2 [PF07724], Evalue: 1.40E-38, Aligned region: 613..779
AAA [PF00004], Evalue: 1.00E-18, Aligned region: 227..329
AAA [PF00004], Evalue: 1.00E-18, Aligned region: 618..702
ClpB_D2-small [PF10431], Evalue: 3.00E-13, Aligned region: 210..221
ClpB_D2-small [PF10431], Evalue: 3.00E-13, Aligned region: 785..859
AAA_5 [PF07728], Evalue: 1.70E-11, Aligned region: 227..246
AAA_5 [PF07728], Evalue: 1.70E-11, Aligned region: 617..735
AAA_16 [PF13191], Evalue: 1.50E-09, Aligned region: 34..65
AAA_16 [PF13191], Evalue: 1.50E-09, Aligned region: 204..243
AAA_16 [PF13191], Evalue: 1.50E-09, Aligned region: 271..306
AAA_16 [PF13191], Evalue: 1.50E-09, Aligned region: 373..393
AAA_16 [PF13191], Evalue: 1.50E-09, Aligned region: 487..545
AAA_16 [PF13191], Evalue: 1.50E-09, Aligned region: 609..661
AAA_16 [PF13191], Evalue: 1.50E-09, Aligned region: 682..700
AAA_22 [PF13401], Evalue: 5.60E-09, Aligned region: 227..307
AAA_22 [PF13401], Evalue: 5.60E-09, Aligned region: 366..393
AAA_22 [PF13401], Evalue: 5.60E-09, Aligned region: 614..643
AAA_22 [PF13401], Evalue: 5.60E-09, Aligned region: 678..700
Sigma54_activat [PF00158], Evalue: 1.10E-06, Aligned region: 222..242
Sigma54_activat [PF00158], Evalue: 1.10E-06, Aligned region: 600..725
IstB_IS21 [PF01695], Evalue: 1.70E-06, Aligned region: 221..248
IstB_IS21 [PF01695], Evalue: 1.70E-06, Aligned region: 615..639
IstB_IS21 [PF01695], Evalue: 1.70E-06, Aligned region: 727..748
AAA_19 [PF13245], Evalue: 8.00E-06, Aligned region: 224..248
AAA_19 [PF13245], Evalue: 8.00E-06, Aligned region: 372..403
AAA_19 [PF13245], Evalue: 8.00E-06, Aligned region: 611..639
AAA_17 [PF13207], Evalue: 5.70E-05, Aligned region: 228..244
AAA_17 [PF13207], Evalue: 5.70E-05, Aligned region: 377..399
AAA_17 [PF13207], Evalue: 5.70E-05, Aligned region: 616..653
RuvB_N [PF05496], Evalue: 5.80E-05, Aligned region: 226..242
RuvB_N [PF05496], Evalue: 5.80E-05, Aligned region: 296..307
RuvB_N [PF05496], Evalue: 5.80E-05, Aligned region: 578..638
RuvB_N [PF05496], Evalue: 5.80E-05, Aligned region: 686..796
Zeta_toxin [PF06414], Evalue: 6.10E-05, Aligned region: 227..244
Zeta_toxin [PF06414], Evalue: 6.10E-05, Aligned region: 616..657
AAA_14 [PF13173], Evalue: 0.00064, Aligned region: 284..307
AAA_14 [PF13173], Evalue: 0.00064, Aligned region: 615..734
AAA_29 [PF13555], Evalue: 0.0007, Aligned region: 217..240
AAA_29 [PF13555], Evalue: 0.0007, Aligned region: 612..642
AAA_18 [PF13238], Evalue: 0.00072, Aligned region: 228..246
AAA_18 [PF13238], Evalue: 0.00072, Aligned region: 618..646
AAA_25 [PF13481], Evalue: 0.0011, Aligned region: 226..251
AAA_25 [PF13481], Evalue: 0.0011, Aligned region: 283..314
AAA_25 [PF13481], Evalue: 0.0011, Aligned region: 361..391
AAA_25 [PF13481], Evalue: 0.0011, Aligned region: 498..538
AAA_25 [PF13481], Evalue: 0.0011, Aligned region: 592..640
AAA_25 [PF13481], Evalue: 0.0011, Aligned region: 790..822
NACHT [PF05729], Evalue: 0.0035, Aligned region: 227..253
NACHT [PF05729], Evalue: 0.0035, Aligned region: 286..334
NACHT [PF05729], Evalue: 0.0035, Aligned region: 617..645
ResIII [PF04851], Evalue: 0.0047, Aligned region: 218..246
ResIII [PF04851], Evalue: 0.0047, Aligned region: 284..308
ResIII [PF04851], Evalue: 0.0047, Aligned region: 589..639
Hpr_kinase_C [PF07475], Evalue: 0.0054, Aligned region: 227..240
Hpr_kinase_C [PF07475], Evalue: 0.0054, Aligned region: 618..635
Arch_ATPase [PF01637], Evalue: 0.0087, Aligned region: 205..240
Arch_ATPase [PF01637], Evalue: 0.0087, Aligned region: 283..311
Arch_ATPase [PF01637], Evalue: 0.0087, Aligned region: 615..638
Protein Sequence: 885 a.a.     [Download]
>gi|83717896|ref|YP_438466.1| unnamed protein product [Burkholderia thailandensis E264]
MSDIGRVTLFGKLNAFLYETLEQATGFCRLRGNPYVELAHWLNQMLQRPDSDVHRVLRRFDIEAAAIDRG
IVSALDRLPRGAGSVSDLSAHIDDAVERAWVYATLKYDATQIRGAVLLLAIVKTAQLRNVLYAIARDFER
IVPDVFADELERIVEGSPEAPPPAARASAGAGGGASPAAREGSALARYAVDLTARARAGEIDPVVGRDGE
IRQIVDILLRRRQNNPLLVGEAGVGKTAVAEGFALRIVAGDVPPPLRDVELYLLDIGLLQAGASVKGEFE
SRLRGVIDEATSSERPVILFVDEVHTLVGAGGAAGTGDAANLLKPALARGLLRTIGATTWSEYKQYIEKD
PALTRRFQLVQVREPEEGAALTMLRGLAAKLEAHHRVLVLDDALQAAVTLSHRYIPARQLPDKAISLLDT
ACARVAVSQHAVPAPIEDARRRIDSLRVERELIARECALGAGDAPRLDAIDASIASEQAALDALDARWQA
ERDALGQIVDWRASLLADDPSRALDETARADVQAKLSAALRALAELQGETPLVLPAVDTHAVAAVVSDWT
GIPLGRMVRDEMQSVLKLADTLAERVVGQRHAVELIAERIQTARARLDDPAKPHGVFLLCGPSGVGKTET
ALALAETLYGGEHNAITINMSEFQEAHTVSTLKGAPPGYVGYGQGGVLTEAVRRRPYSVVLLDEIEKAHR
DVHEIFFQVFDKGWMEDGEGRYIDFRNTVILLTSNVGSERVMQLCRDPQRLPDAQTLTDALRAPLREVFP
AALLGRLSVVPYYPLTDEMLARIVALQLARIERRIESHHGIALRCEDSATALIVERCRTIESGGRMVDAI
LTHTVLPRISQEILRATIEGRALRAIDVSAEDGQFVYRFEEEGAT
 
Nucleotide Sequence: 2658 bp     [Download]
>gi|83716035|ref|NC_007650.1|:323701-326358 Burkholderia thailandensis E264 chromosome II, complete sequence
ATGTCCGATATCGGCCGAGTGACCTTGTTCGGAAAGCTGAACGCTTTTCTCTACGAGACATTGGAGCAGG
CGACGGGCTTCTGCCGGCTGCGCGGCAATCCGTACGTCGAGCTCGCGCACTGGCTGAACCAGATGCTCCA
GCGCCCGGACAGCGACGTGCACCGGGTCCTGCGCCGCTTCGACATCGAAGCGGCCGCGATCGATCGCGGG
ATCGTCTCGGCGCTCGACCGGTTGCCGCGCGGCGCGGGCTCCGTGTCCGATCTGTCCGCGCACATCGACG
ACGCGGTCGAGCGCGCGTGGGTCTACGCGACGCTCAAATACGACGCGACGCAGATCCGCGGCGCGGTGCT
GCTGCTCGCGATCGTGAAGACGGCGCAACTGCGCAACGTGCTGTATGCGATCGCGCGCGACTTCGAGCGG
ATCGTGCCGGACGTGTTCGCCGACGAACTCGAGCGGATCGTCGAAGGCTCGCCGGAAGCGCCGCCGCCGG
CGGCGCGCGCATCGGCGGGCGCGGGGGGCGGCGCATCGCCCGCCGCGCGGGAAGGCTCGGCGCTCGCGCG
CTACGCGGTCGATCTGACCGCGCGGGCGCGCGCGGGTGAGATCGATCCGGTGGTGGGCCGCGACGGCGAG
ATTCGTCAGATCGTCGACATCCTGCTGCGCCGCCGGCAGAACAATCCGCTGCTCGTCGGCGAGGCGGGCG
TCGGCAAGACCGCGGTCGCAGAAGGCTTCGCGCTGCGCATCGTCGCGGGCGACGTGCCGCCGCCGCTGCG
CGACGTCGAACTGTATCTGCTCGACATCGGCCTGCTGCAAGCGGGCGCGAGCGTGAAGGGCGAATTCGAG
AGCCGCCTGCGCGGCGTGATCGACGAGGCGACATCGAGCGAGCGGCCCGTCATTCTGTTCGTCGACGAGG
TGCATACGCTCGTCGGCGCGGGCGGCGCGGCGGGCACGGGCGACGCGGCGAACCTCTTGAAGCCCGCGCT
CGCGCGCGGCCTGCTGCGCACGATCGGCGCGACGACGTGGTCCGAGTACAAGCAGTACATCGAGAAGGAC
CCGGCGCTCACGCGGCGCTTCCAGCTCGTGCAGGTGCGCGAGCCGGAGGAGGGCGCGGCGCTGACGATGC
TGCGCGGACTCGCCGCGAAGCTGGAGGCGCACCACCGCGTGCTCGTGCTCGACGATGCGTTGCAGGCGGC
CGTCACGCTGTCGCATCGCTACATTCCGGCGCGGCAATTGCCCGACAAGGCGATCAGCCTGCTCGACACC
GCGTGCGCGCGCGTCGCGGTCAGCCAGCACGCGGTGCCCGCGCCGATCGAGGATGCGCGGCGGCGGATCG
ACAGCCTGCGCGTCGAGCGCGAACTGATCGCGCGCGAGTGCGCGCTCGGCGCGGGCGATGCGCCGCGGCT
CGATGCGATCGATGCGTCGATCGCGAGCGAACAGGCCGCGCTCGATGCGCTCGACGCGCGCTGGCAGGCG
GAGCGCGACGCGCTCGGCCAGATCGTCGACTGGCGGGCCTCGCTGCTGGCCGACGATCCTTCGCGCGCGC
TCGATGAGACGGCGCGCGCGGACGTGCAGGCGAAGCTCTCGGCTGCGCTGCGCGCGCTCGCCGAGTTGCA
GGGCGAGACGCCGCTCGTGCTGCCCGCGGTCGACACGCACGCGGTGGCCGCCGTCGTGTCCGACTGGACC
GGCATCCCGCTCGGCCGGATGGTGCGTGACGAGATGCAATCGGTGCTGAAGCTCGCCGACACGCTCGCCG
AGCGTGTGGTCGGCCAGCGGCACGCGGTCGAGCTGATCGCCGAGCGCATCCAGACCGCGCGCGCGCGGCT
CGACGATCCGGCCAAGCCGCACGGCGTGTTCCTGCTGTGCGGGCCGTCCGGCGTCGGCAAGACCGAGACG
GCGCTCGCGCTCGCCGAGACGCTGTACGGCGGCGAGCACAACGCGATCACGATCAACATGAGCGAGTTCC
AGGAGGCGCATACCGTATCGACGCTCAAGGGCGCGCCGCCCGGCTACGTCGGCTACGGACAGGGCGGCGT
GCTGACCGAGGCGGTGCGGCGGCGGCCGTACAGCGTCGTGCTGCTCGACGAAATCGAGAAGGCGCACCGC
GACGTGCACGAGATCTTCTTTCAGGTGTTCGACAAGGGCTGGATGGAAGACGGCGAAGGGCGCTACATCG
ACTTTCGCAACACGGTGATCCTCCTCACGTCGAACGTCGGTTCCGAGCGCGTGATGCAGCTGTGCCGCGA
CCCGCAGCGCCTGCCCGATGCGCAGACCTTGACCGATGCGCTGCGCGCGCCGCTGCGCGAAGTGTTCCCC
GCCGCGTTGTTGGGACGCCTGAGCGTCGTGCCGTACTACCCGCTCACCGACGAGATGCTCGCGCGGATCG
TCGCGTTGCAGCTCGCGCGCATCGAGCGCCGAATCGAATCGCACCACGGCATCGCGCTGCGCTGCGAGGA
TTCGGCGACCGCGCTGATCGTCGAGCGCTGCCGGACGATCGAATCCGGCGGCCGGATGGTCGACGCGATT
CTCACGCACACGGTGCTGCCGCGCATCAGCCAGGAGATCCTGCGCGCGACGATCGAGGGGCGCGCGCTGC
GGGCGATCGACGTGAGCGCCGAAGACGGCCAGTTCGTTTATCGATTCGAAGAGGAGGGTGCGACGTGA