SecReT6
Protein ID: 83717986
SecReT6 ID111
T6SS typei3
Gene symbol-
Locus tagBTH_II0125
StrainBurkholderia thailandensis E264
Repliconchromosome II [GenBank: NC_007650] [Browse all T6SS(s) in this replicon]
Location [Strand]143770..145212 [+]
Producthypothetical protein
NoteTssK
UniProt IDQ2T922
KEGG IDbte:BTH_II0125
PDB IDNA
Domain hit(s) vs Pfam DUF876 [PF05936], Evalue: 2.60E-142, Aligned region: 51..478
Protein Sequence: 480 a.a.     [Download]
>gi|83717986|ref|YP_438327.1| unnamed protein product [Burkholderia thailandensis E264]
MVPGIHAKDEDQVERRCRAANRVDYRIGMIAMSWHNKVVWNEGLFLLPQLFQQQERYFEYFAHKRAAVLS
PFFWGFSRYEIDQESLSFGKLVFKSGTGIFSDGTPFDVPGHTPPPPPLTIASEHQDQVIYLAVPLRLPNT
EETAFDEQAGSLARYSAFEIELRDSNAIGQGPKPVQLANMRLRLLPEKELTQSWIGIALTRVKTLHADGS
VALHDGDHIPPVSQYGANPLLREWATQLHGLAKLRADALATRLSGSDGRAGAAAEVADYLLLQVLNRYEP
LLEHICRIREMPPVTLYRELSMLAGELSTFVRPQTRRPRPTPGYDHAQLYASIRPLVDEVHYLLNQVLIR
GAQPIPLTEQPHGIRVATMLPSELAGYSSLVLAVGAQMSPDVLQQQFASQTKISHPQRLPELIRSHLPGM
TMIPLPVPPRQIPFNSSYIYYELSRTGPFWEQIAQQGGLAMHIAGHFPELKLELWGVRHK
 
Nucleotide Sequence: 1443 bp     [Download]
>gi|83716035|ref|NC_007650.1|:143770-145212 Burkholderia thailandensis E264 chromosome II, complete sequence
ATGGTACCGGGCATTCACGCCAAGGACGAAGATCAAGTTGAACGTCGATGTCGGGCAGCAAACCGTGTCG
ATTACAGAATTGGAATGATTGCGATGAGCTGGCATAACAAGGTGGTGTGGAACGAAGGGCTGTTTCTTCT
TCCCCAGTTGTTTCAACAACAGGAACGTTACTTCGAATACTTCGCGCACAAGCGGGCCGCTGTCCTCAGC
CCGTTTTTCTGGGGATTCAGCCGATACGAAATCGATCAGGAGTCGCTGTCGTTCGGCAAGCTCGTCTTCA
AGAGCGGCACCGGAATATTTTCCGACGGCACGCCGTTCGATGTGCCGGGGCACACGCCGCCGCCGCCGCC
GCTGACGATTGCTTCGGAGCACCAGGATCAGGTGATCTATCTCGCGGTGCCGCTGCGTCTGCCGAATACG
GAGGAAACCGCGTTCGACGAACAAGCGGGATCGCTTGCGCGCTATTCGGCGTTCGAGATCGAATTGCGCG
ACAGCAATGCGATCGGTCAAGGGCCCAAGCCGGTGCAGCTCGCGAACATGCGGCTGCGCCTGCTGCCCGA
GAAGGAGCTGACGCAATCCTGGATCGGCATTGCGCTGACGCGCGTGAAGACGCTTCACGCCGACGGCTCG
GTTGCGCTGCACGACGGCGATCATATCCCGCCGGTCAGCCAATACGGGGCGAATCCGCTGCTGCGCGAAT
GGGCCACCCAGTTGCATGGTCTCGCGAAGCTGCGCGCCGACGCGCTCGCGACACGCCTGTCCGGCAGCGA
TGGCCGCGCAGGCGCGGCGGCCGAGGTGGCGGATTATCTGTTGCTGCAGGTGCTGAACCGGTATGAGCCG
CTGCTCGAGCACATCTGCAGGATTCGCGAAATGCCGCCCGTGACGCTCTATCGCGAGTTGTCGATGCTGG
CGGGCGAATTGTCGACGTTCGTGCGTCCGCAAACGCGCCGGCCCCGGCCGACGCCCGGCTACGATCACGC
GCAGTTGTACGCGAGCATTCGCCCGCTGGTCGACGAGGTGCATTACCTGTTGAACCAGGTGCTGATTCGA
GGCGCCCAGCCGATTCCGCTCACCGAGCAGCCGCACGGCATTCGCGTGGCCACGATGTTGCCGTCTGAGC
TCGCGGGTTATTCGAGCCTCGTGCTCGCGGTCGGCGCGCAAATGTCTCCGGACGTGCTGCAGCAGCAGTT
CGCATCCCAAACGAAGATCAGCCATCCGCAGCGGCTGCCGGAGCTCATTCGCTCTCACTTGCCGGGCATG
ACGATGATTCCGTTGCCGGTGCCTCCGCGGCAGATTCCGTTCAATTCCAGTTATATCTATTACGAGCTTT
CCCGCACGGGGCCGTTCTGGGAACAGATCGCACAACAAGGCGGGCTTGCGATGCACATCGCGGGTCACTT
CCCTGAACTCAAGCTCGAACTTTGGGGAGTGCGTCACAAATGA