SecReT6
Protein ID: 83718015
SecReT6 ID114
T6SS typei3
Gene symbol-
Locus tagBTH_II1899
StrainBurkholderia thailandensis E264
Repliconchromosome II [GenBank: NC_007650] [Browse all T6SS(s) in this replicon]
Location [Strand]2304861..2305388 [-]
Producthypothetical protein
NoteTssD
UniProt IDQ2T406
KEGG IDbte:BTH_II1899
PDB IDNA
Domain hit(s) vs Pfam DUF796 [PF05638], Evalue: 6.50E-32, Aligned region: 9..150
Protein Sequence: 175 a.a.     [Download]
>gi|83718015|ref|YP_440093.1| unnamed protein product [Burkholderia thailandensis E264]
MANALVDYFLQIDGVEGESTDSQYPGLIQIQSWQWAEENSGRWGFGSGGGAGKVEMKDFEFRMVSNKASP
KLFLMCATGEHIQNAKLICRKSGKGQQEFLTISFASGLVSSFRTLGNMPISQLGHASGEVDGVLPTDQIR
INFAQIEFEYREQRNDGTMGAVIKAGYDLKQNAPI
 
Nucleotide Sequence: 528 bp     [Download]
>gi|83716035|ref|NC_007650.1|:c2305388-2304861 Burkholderia thailandensis E264 chromosome II, complete sequence
ATGGCAAATGCTTTGGTTGATTACTTCTTGCAGATCGACGGCGTCGAGGGTGAGTCGACCGATTCGCAAT
ATCCCGGTCTGATCCAGATTCAGAGCTGGCAGTGGGCGGAAGAGAACTCGGGCCGCTGGGGCTTCGGCAG
CGGCGGCGGCGCGGGCAAGGTCGAGATGAAGGACTTCGAGTTCCGCATGGTGTCGAACAAGGCTTCGCCG
AAGCTGTTCCTGATGTGTGCGACGGGTGAGCACATCCAGAACGCGAAGCTGATCTGCCGCAAGTCGGGCA
AGGGCCAGCAGGAATTCCTGACGATCTCGTTCGCGAGCGGCCTCGTCTCGTCGTTCCGCACGCTCGGCAA
CATGCCGATCTCGCAGCTCGGCCACGCTAGCGGCGAAGTCGACGGCGTGCTGCCGACCGACCAGATCCGG
ATCAACTTCGCCCAGATCGAGTTCGAGTACCGCGAGCAGCGCAACGACGGCACGATGGGCGCAGTGATCA
AGGCCGGATACGACCTCAAGCAGAACGCCCCGATCTAA