SecReT6
Protein ID: 83718123
SecReT6 ID111
T6SS typei3
Gene symbol-
Locus tagBTH_II0137
StrainBurkholderia thailandensis E264
Repliconchromosome II [GenBank: NC_007650] [Browse all T6SS(s) in this replicon]
Location [Strand]164085..164603 [-]
Producthypothetical protein
NoteTssE
UniProt IDQ2T910
KEGG IDbte:BTH_II0137
PDB IDNA
Domain hit(s) vs Pfam GPW_gp25 [PF04965], Evalue: 4.60E-19, Aligned region: 38..148
Protein Sequence: 172 a.a.     [Download]
>gi|83718123|ref|YP_438339.1| unnamed protein product [Burkholderia thailandensis E264]
MRHPEGRHRAAYLPSLLDRLQDDAPHSFSESPDAYAPSADEMRRIVQRDLSLLLNTSNLDDEVDAGRYPL
VAASVVNYGVPPLSGSYLHDPNRETIDRLVRTAIVHFEPRLIADSLAIRPLAAQQGASYNKLTFEISALV
QWSPYPLELRIQSTFDLELNRVTLDKTTLNGK
 
Nucleotide Sequence: 519 bp     [Download]
>gi|83716035|ref|NC_007650.1|:c164603-164085 Burkholderia thailandensis E264 chromosome II, complete sequence
ATGCGGCATCCTGAAGGACGGCATCGGGCCGCCTACCTTCCGTCGCTGCTCGACCGGCTGCAAGACGACG
CGCCGCATTCCTTCAGCGAATCGCCCGACGCCTATGCGCCAAGCGCCGACGAGATGCGTCGCATCGTCCA
GCGGGATCTGAGCCTGCTGCTCAACACGAGCAATCTGGACGACGAAGTGGATGCCGGCCGCTATCCGCTC
GTTGCGGCCTCCGTCGTCAACTATGGCGTGCCGCCGTTGTCGGGCAGCTACCTGCACGACCCAAACCGGG
AAACGATCGATCGCCTCGTGCGCACCGCGATCGTTCATTTCGAGCCGCGACTCATTGCGGACTCCTTGGC
GATCAGGCCGCTCGCGGCGCAACAGGGCGCCAGCTACAACAAACTGACGTTCGAAATCAGCGCGCTCGTG
CAATGGTCGCCGTATCCGCTGGAGTTGCGCATCCAGAGCACGTTCGACCTCGAGTTGAATCGAGTCACGC
TCGACAAGACAACGCTCAACGGAAAATGA