SecReT6
Protein ID: 83718208
SecReT6 ID114
T6SS typei3
Gene symbol-
Locus tagBTH_II1888
StrainBurkholderia thailandensis E264
Repliconchromosome II [GenBank: NC_007650] [Browse all T6SS(s) in this replicon]
Location [Strand]2288867..2289346 [-]
Productlipoprotein
NoteTssJ
UniProt IDQ2T417
KEGG IDbte:BTH_II1888
PDB IDNA
Domain hit(s) vs Pfam T6SS-SciN [PF12790], Evalue: 9.40E-05, Aligned region: 2..116
Protein Sequence: 159 a.a.     [Download]
>gi|83718208|ref|YP_440082.1| unnamed protein product [Burkholderia thailandensis E264]
MTLVGGSRLNAAPTGEARPIQTCVYVVTAADWLPTQGGDDSSCASRGQDSTVVADSRHVIAPNQVLQFSL
NLPRSGDIWLVADADYARRPANYGPLRVRIEGRGLIHMAVWLDRDGIYNALLPGPVPVGGAIAASAIRTD
EPPPERRTKTTYGIRRSRQ
 
Nucleotide Sequence: 480 bp     [Download]
>gi|83716035|ref|NC_007650.1|:c2289346-2288867 Burkholderia thailandensis E264 chromosome II, complete sequence
GTGACGCTCGTCGGCGGCAGCCGGCTGAACGCCGCGCCGACGGGCGAGGCGCGTCCGATCCAGACGTGCG
TGTATGTCGTGACGGCGGCGGACTGGCTGCCCACGCAAGGCGGCGACGATTCGTCGTGCGCGTCGCGCGG
GCAGGACAGCACGGTCGTCGCCGACTCGCGTCACGTGATCGCGCCGAACCAGGTGCTGCAGTTCTCGCTG
AACCTGCCGCGCTCCGGCGACATCTGGCTCGTCGCCGACGCCGACTACGCGCGCCGGCCGGCGAACTACG
GGCCGCTGCGCGTGCGCATCGAGGGCCGCGGATTGATTCACATGGCTGTCTGGCTTGACCGCGACGGCAT
CTACAACGCGTTGTTGCCGGGGCCCGTGCCCGTCGGCGGCGCGATCGCCGCATCGGCGATCCGCACCGAC
GAGCCGCCGCCCGAGCGCAGAACGAAAACCACCTATGGGATAAGGAGAAGCAGGCAATGA