SecReT6
Protein ID: 83718246
SecReT6 ID111
T6SS typei3
Gene symbol-
Locus tagBTH_II0129
StrainBurkholderia thailandensis E264
Repliconchromosome II [GenBank: NC_007650] [Browse all T6SS(s) in this replicon]
Location [Strand]151273..153891 [+]
ProductRhs element Vgr protein
NoteTssI
UniProt IDQ2T918
KEGG IDbte:BTH_II0129
PDB IDNA
Domain hit(s) vs Pfam Phage_GPD [PF05954], Evalue: 1.50E-79, Aligned region: 41..368
Phage_base_V [PF04717], Evalue: 8.00E-25, Aligned region: 408..501
Gp5_C [PF06715], Evalue: 0.0042, Aligned region: 552..573
Gp5_C [PF06715], Evalue: 0.0042, Aligned region: 585..601
Gp5_C [PF06715], Evalue: 0.0042, Aligned region: 593..614
Gp5_C [PF06715], Evalue: 0.0042, Aligned region: 613..630
Gp5_C [PF06715], Evalue: 0.0042, Aligned region: 618..637
Protein Sequence: 872 a.a.     [Download]
>gi|83718246|ref|YP_438331.1| unnamed protein product [Burkholderia thailandensis E264]
MPNHFSNGRTNQSRTVVIRSGAMPRLLGQPALKFLSLRGEEHLGKLYTYELLLRTPDDFHVPLATSANLD
LKAMIGTEMTVGIQLDGIGTGAQGGVGAGAREISGLVVKAGFLRSEGRYNVYRIELRPWLWLATLTSDYK
IFQDKSVVEIIDTVLHDYPYPVEKRLDIDKYSVAGESARNEPRAFQVQYGETDFDFVQRLMEEWGIYWFF
EHSDNKHRLVLCDHIGGHRKAPSEAYHEIAHHPEGGKIDIEYINYFSTDEALRPGRVVIDDFDFTRPLAS
LVTSNHQPRETNWGEGELFEWPGDYTDSKHGDLISRVRMEERRATGSRAYGRGNVRGLACGHTFVLAKHK
HDDANREYLVIESALMLTEVADETGSGYRYECDNELVVQPSNEVFRMPRETPKPTTNGPQSAIVVGPPGH
EVWTDEFGRVKIRFLWDRYARNDATDSCWVRVSQAWAGVNFGGIYIPRIGQEVIVGFMNGDPDRPLILGS
LYNTITPPPWDLPGDATKSGFKSKSITGGRENYNGIRFEDKLGAEEFHMQAEKDMNRLTKNDESHTIGAN
YSIGVGITHTRAVGAMFSSIVGGAASYAVGGAESTMIGGAYALNVGGAHAVAVGGASSVSVGGAYARNVG
GAYALTVGGVLSIVCGASSITMTACGSIKIVGKNIRIIGSDEVVVQGAPLQLNPGDSDCGGGGGGGGGGG
AIPPIPLPSFFLDITKPILPPPPPPPTEVPPEPTPTPEPTPTPEPTPTPTPTPTPTPTPTPTPTPTPTPT
PTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPT
PTPTPTPTPTPTPTPTPTPTPTPTPTPTSSEI
 
Nucleotide Sequence: 2619 bp     [Download]
>gi|83716035|ref|NC_007650.1|:151273-153891 Burkholderia thailandensis E264 chromosome II, complete sequence
ATGCCAAACCATTTTTCGAACGGACGGACGAATCAAAGCCGTACGGTAGTGATCCGCAGCGGTGCGATGC
CGCGGCTGCTTGGTCAGCCTGCGCTCAAGTTCCTGTCGCTGCGCGGTGAAGAGCACCTCGGAAAACTCTA
TACGTACGAACTGCTCCTGCGCACGCCGGACGATTTCCATGTTCCGTTGGCGACGAGCGCGAATCTCGAC
CTGAAGGCGATGATCGGCACGGAGATGACTGTCGGCATTCAGCTCGACGGAATCGGAACGGGCGCGCAAG
GGGGCGTTGGCGCGGGCGCGCGCGAAATCAGCGGGCTCGTGGTCAAGGCGGGCTTTCTTCGCAGCGAAGG
GCGCTACAACGTCTATCGCATCGAGCTGCGCCCCTGGCTGTGGCTCGCGACTTTGACGAGCGACTACAAG
ATCTTCCAGGACAAGAGCGTCGTCGAAATCATCGACACGGTCTTGCACGATTACCCTTACCCGGTCGAGA
AGCGGCTCGACATCGACAAATATTCGGTTGCGGGCGAGAGCGCTCGAAACGAGCCGCGCGCGTTCCAGGT
GCAATACGGCGAAACCGATTTCGACTTCGTTCAGCGCTTGATGGAGGAGTGGGGGATCTACTGGTTCTTC
GAGCACTCGGACAACAAGCATCGCCTTGTCTTGTGCGATCACATCGGCGGACATCGCAAGGCGCCGAGCG
AGGCCTATCACGAGATCGCGCATCATCCCGAAGGCGGGAAGATCGACATCGAGTACATCAACTATTTTTC
GACGGACGAAGCGCTGCGGCCGGGCCGCGTCGTGATAGACGACTTCGATTTCACGCGTCCGCTCGCGAGC
CTCGTCACGTCGAATCACCAGCCGCGGGAAACGAACTGGGGAGAAGGCGAGCTGTTCGAATGGCCGGGCG
ACTACACCGATAGCAAGCACGGCGATCTCATTAGCCGTGTGCGCATGGAGGAGCGCCGCGCTACGGGGTC
GCGCGCATACGGTCGGGGCAACGTGCGCGGCCTCGCATGCGGCCATACGTTCGTGTTGGCGAAGCACAAG
CACGACGACGCCAACCGCGAGTATCTCGTCATCGAATCGGCGTTGATGCTGACCGAAGTCGCGGACGAAA
CGGGCAGCGGCTACCGCTACGAATGCGACAACGAGTTGGTCGTGCAGCCGTCGAACGAGGTGTTCCGGAT
GCCGCGCGAAACGCCGAAGCCGACGACGAACGGGCCACAGTCCGCGATCGTGGTCGGGCCGCCGGGCCAC
GAGGTATGGACCGACGAATTCGGCCGCGTGAAGATCCGTTTTCTGTGGGATCGCTACGCACGCAATGACG
CGACGGATTCCTGCTGGGTGCGCGTGAGCCAGGCGTGGGCCGGCGTGAACTTCGGCGGCATCTACATTCC
GCGGATCGGCCAGGAGGTGATCGTCGGATTCATGAACGGCGACCCTGACCGTCCGCTGATTCTCGGCAGT
CTCTACAACACCATTACGCCGCCGCCTTGGGATCTGCCCGGCGACGCGACGAAGAGCGGGTTCAAGAGCA
AGTCGATCACGGGCGGGCGCGAGAACTACAACGGCATCCGCTTCGAGGACAAGCTGGGGGCCGAGGAGTT
TCACATGCAGGCGGAAAAGGACATGAACCGCCTGACGAAGAACGACGAGTCGCATACGATCGGCGCGAAT
TATTCGATCGGCGTCGGGATCACCCACACGCGAGCGGTGGGCGCCATGTTCAGCAGCATTGTCGGCGGAG
CCGCCAGCTATGCGGTGGGCGGCGCGGAGTCGACGATGATCGGCGGTGCGTATGCGTTGAACGTCGGCGG
TGCGCACGCGGTTGCGGTGGGCGGCGCATCGTCCGTTTCCGTTGGCGGCGCATACGCGCGCAATGTCGGC
GGCGCGTATGCGCTGACAGTGGGGGGCGTGCTGTCGATCGTCTGCGGCGCGTCTTCGATCACCATGACGG
CCTGCGGCTCGATCAAGATCGTCGGCAAGAATATTCGCATCATCGGCAGCGACGAAGTCGTCGTGCAAGG
CGCGCCGCTGCAGCTGAATCCCGGCGATTCGGATTGCGGAGGCGGAGGCGGCGGTGGCGGCGGTGGCGGC
GCGATTCCGCCGATTCCGTTGCCGTCGTTCTTCCTCGATATTACGAAGCCGATCCTTCCGCCGCCGCCGC
CGCCACCGACGGAGGTGCCGCCGGAGCCGACGCCGACGCCGGAGCCGACGCCAACGCCGGAGCCAACGCC
AACGCCAACGCCGACGCCGACGCCGACGCCGACGCCAACGCCAACGCCAACGCCAACGCCAACGCCAACG
CCAACGCCAACGCCAACGCCAACGCCAACGCCAACGCCAACGCCAACGCCGACGCCGACGCCGACGCCGA
CGCCAACGCCGACGCCGACGCCGACGCCAACGCCAACGCCAACGCCGACGCCGACGCCGACGCCGACGCC
GACGCCGACGCCGACGCCAACGCCAACGCCGACGCCGACGCCAACGCCGACGCCGACGCCAACGCCGACG
CCAACGCCAACGCCGACGCCGACGCCAACGCCAACGCCGACGCCGACGCCGACGCCGACGCCAACGCCAA
CGCCAACTCCGACCAGTTCCGAGATTTGA