SecReT6
Protein ID: 83718249
SecReT6 ID114
T6SS typei3
Gene symbol-
Locus tagBTH_II1900
StrainBurkholderia thailandensis E264
Repliconchromosome II [GenBank: NC_007650] [Browse all T6SS(s) in this replicon]
Location [Strand]2305532..2307037 [-]
Producthypothetical protein
NoteTssC
UniProt IDQ2T405
KEGG IDbte:BTH_II1900
PDB IDNA
Domain hit(s) vs Pfam DUF877 [PF05943], Evalue: 3.80E-183, Aligned region: 67..493
Protein Sequence: 501 a.a.     [Download]
>gi|83718249|ref|YP_440094.1| unnamed protein product [Burkholderia thailandensis E264]
MQQLESSAEKVVVDQNNVNEDLKDILRRSFRPRTNEAAEAVQNAVETLLTYARRSRVVVREDVAQTIEQL
VAELDKKISEQLTLVLHNKRFQSLEGAWRGLHYLVSNTDTSENLKIRYLNISKADLGKTLRRFKGVVWDQ
SPIFKMIYEQEYGQFGGEPFGCLIGDFYFDHSMQDVSILTEMSKISAAAHAPFIAAAAPGLLQMDDWSEL
SNPRDVSKIFTATEYAFWRRLRESNDSRYLALTLPRFLARVPYGPKTQPVEEFGFEEKVDPNRAEDFCWA
NSAYAMGANITRAFKTYGWCTKIRGVESGGAVEVLPKFVLPSQDREVDLHCPTEIAISDRREHELSESGL
MPLVYRKNSDTAAFIGAKTVHRPAIYEDDDATANSNLSSRLPYIFATCRFAHYLKCIVRDKIGSFKSAED
TQRWLNDWLMNYVDGDPSISSEVTKSQRPLSAAEVVVDEIPENPGYYRAQFFLRPHFQLEGLTVSLRLVS
KLPSTKQEVTT
 
Nucleotide Sequence: 1506 bp     [Download]
>gi|83716035|ref|NC_007650.1|:c2307037-2305532 Burkholderia thailandensis E264 chromosome II, complete sequence
ATGCAGCAGCTTGAATCGTCTGCCGAGAAGGTGGTCGTCGATCAGAACAATGTCAACGAGGATCTGAAGG
ACATCCTGCGCCGCTCGTTTCGGCCGCGCACCAACGAGGCGGCCGAGGCGGTGCAGAACGCCGTCGAGAC
CCTGCTCACGTATGCGCGGCGCAGCCGCGTCGTGGTTCGCGAGGATGTCGCGCAGACGATCGAGCAGTTG
GTTGCCGAGCTCGACAAGAAGATTTCCGAGCAACTGACGCTCGTGCTGCACAACAAGCGCTTCCAGAGTC
TCGAAGGCGCATGGCGCGGATTGCACTACCTCGTGTCGAACACCGACACGAGCGAGAACCTGAAGATCCG
CTACCTGAACATCTCGAAAGCGGATCTCGGCAAGACGCTGCGGCGCTTCAAGGGCGTCGTGTGGGACCAG
AGTCCGATTTTCAAGATGATCTACGAGCAGGAGTACGGCCAGTTCGGCGGCGAGCCGTTCGGCTGCCTGA
TCGGTGACTTCTACTTCGACCACAGCATGCAGGACGTGTCGATCCTCACCGAGATGTCGAAGATCTCGGC
GGCCGCGCACGCGCCGTTCATCGCGGCCGCGGCGCCGGGCCTGCTGCAGATGGACGACTGGAGCGAGCTG
TCGAATCCGCGCGACGTGTCGAAGATCTTTACCGCGACCGAATACGCGTTCTGGCGGCGCCTGCGCGAGA
GCAACGACTCGCGCTACCTCGCGCTCACGCTGCCGCGCTTTCTCGCGCGCGTGCCGTATGGCCCGAAGAC
GCAGCCCGTCGAAGAGTTCGGATTCGAGGAGAAGGTCGATCCGAACCGCGCCGAGGACTTCTGCTGGGCG
AACTCCGCCTATGCGATGGGCGCGAACATCACGCGCGCGTTCAAGACCTACGGCTGGTGCACGAAGATTC
GCGGCGTCGAGTCGGGCGGCGCGGTCGAGGTGCTGCCGAAGTTCGTGCTGCCGTCGCAGGATCGCGAAGT
CGATCTGCACTGCCCGACCGAAATCGCGATCTCGGACCGCCGCGAGCACGAGCTGTCGGAATCCGGCCTG
ATGCCGCTCGTGTATCGGAAGAACTCGGATACGGCTGCGTTCATCGGCGCGAAGACCGTGCACCGTCCGG
CAATCTACGAGGACGACGACGCGACCGCGAACTCGAATCTGTCGTCGCGGCTGCCGTACATCTTCGCGAC
GTGCCGCTTCGCGCACTACCTGAAGTGCATCGTGCGCGACAAGATCGGTTCGTTCAAGTCGGCCGAGGAC
ACGCAGCGTTGGCTCAACGACTGGCTGATGAACTACGTGGACGGCGACCCGAGCATCTCGAGCGAGGTGA
CGAAATCGCAGCGTCCGCTGTCGGCGGCGGAAGTGGTCGTCGACGAGATTCCGGAGAACCCCGGCTACTA
TCGCGCGCAGTTTTTCCTGCGCCCCCATTTCCAACTGGAGGGTTTGACCGTTTCTCTCCGGCTGGTTTCG
AAGCTTCCGTCGACCAAGCAAGAGGTGACGACCTGA