SecReT6
Protein ID: 83718279
SecReT6 ID114
T6SS typei3
Gene symbol-
Locus tagBTH_II1896
StrainBurkholderia thailandensis E264
Repliconchromosome II [GenBank: NC_007650] [Browse all T6SS(s) in this replicon]
Location [Strand]2301489..2302478 [-]
Producthypothetical protein
NoteTssG
UniProt IDQ2T409
KEGG IDbte:BTH_II1896
PDB IDNA
Domain hit(s) vs Pfam DUF1305 [PF06996], Evalue: 1.70E-58, Aligned region: 13..312
Protein Sequence: 329 a.a.     [Download]
>gi|83718279|ref|YP_440090.1| unnamed protein product [Burkholderia thailandensis E264]
MTTLERVSRALTPRRTFFELMRRVEALQRKHDKRLARKRRMPKWLRIEQPAEMHFASTEVERVHVALARF
IEDDDHPQVTVVQRHFGLFAPYGPLPLHVTEHAMQEKRFERNAAFERFVNVVCGDLAWLHYSAWSSMHPV
LGYERARNPFVERVTALADARRAQQEGGEPFEQHALACRRAFPGIYCAPRRSLADLQRMLCAYFGVALQV
VPRHGRWVPVPAAQSHARRLGGWRLGARIWDVQHSVEIVVGPIEADEFYRWQRRAAAVMALSAVVTDFVD
GRIYPVIKVQVWTRPELAGRVGCMRVGVDAWSRPNRALRTLTVFESFRD
 
Nucleotide Sequence: 990 bp     [Download]
>gi|83716035|ref|NC_007650.1|:c2302478-2301489 Burkholderia thailandensis E264 chromosome II, complete sequence
ATGACGACGCTCGAGCGCGTGAGCCGAGCGCTGACGCCGCGCCGCACGTTCTTCGAGCTGATGCGGCGCG
TCGAAGCGCTGCAGCGCAAGCACGACAAGCGTTTGGCGCGTAAGCGCCGGATGCCGAAGTGGTTGCGCAT
CGAGCAGCCGGCGGAGATGCATTTCGCGAGCACGGAAGTCGAGCGCGTGCACGTGGCGCTCGCGCGCTTC
ATCGAGGACGACGATCACCCGCAGGTCACGGTGGTCCAGCGTCACTTCGGGTTGTTCGCGCCGTATGGGC
CGCTGCCGCTGCACGTGACCGAGCACGCGATGCAGGAGAAGCGCTTCGAGCGCAACGCCGCGTTCGAGCG
CTTCGTCAACGTCGTGTGCGGCGATCTCGCATGGCTGCATTACTCGGCGTGGTCGTCGATGCATCCGGTG
CTCGGCTACGAGCGTGCGCGCAATCCGTTCGTCGAGCGCGTGACGGCGCTCGCCGATGCGCGCCGCGCGC
AGCAGGAGGGCGGCGAGCCGTTCGAGCAGCACGCGCTCGCATGCCGGCGTGCGTTTCCGGGCATTTACTG
CGCGCCGCGCCGCTCGCTTGCCGATCTGCAGCGGATGCTGTGCGCGTACTTCGGCGTCGCGCTGCAGGTC
GTGCCGCGCCACGGCCGCTGGGTGCCGGTGCCGGCCGCGCAGAGCCATGCGCGGCGGCTTGGCGGATGGC
GGCTCGGCGCGCGGATCTGGGACGTGCAGCATTCGGTCGAGATCGTCGTCGGTCCGATCGAGGCCGACGA
GTTCTACCGGTGGCAACGCCGCGCGGCGGCAGTGATGGCGCTGTCCGCGGTCGTGACGGATTTCGTCGAC
GGACGAATTTACCCCGTCATCAAGGTTCAGGTGTGGACGCGCCCTGAACTCGCAGGAAGGGTTGGGTGCA
TGCGCGTCGGCGTCGACGCGTGGTCACGGCCGAATCGGGCGCTGCGCACCCTGACTGTCTTTGAATCTTT
TCGGGACTAG