SecReT6
Protein ID: 83718738
SecReT6 ID115
T6SS typei4b
Gene symbol-
Locus tagBTH_I2966
StrainBurkholderia thailandensis E264
Repliconchromosome I [GenBank: NC_007651] [Browse all T6SS(s) in this replicon]
Location [Strand]3413202..3414080 [+]
Producthypothetical protein
NoteTssJ
UniProt IDQ2SUC6
KEGG IDbte:BTH_I2966
PDB IDNA
Domain hit(s) vs Pfam T6SS-SciN [PF12790], Evalue: 5.10E-37, Aligned region: 103..264
Protein Sequence: 292 a.a.     [Download]
>gi|83718738|ref|YP_443473.1| hypothetical protein BTH_I2966 [Burkholderia thailandensis E264]
MKSGRFKSSAARRLTRHANSGDHRVPLPLQLLPQRNSISLNRWKIFPNNTALPAVIRHLKSQTFLCSQIG
NATDSFDREQRAPRPEKSMNPLVTRYALPLAACILLGGCAAAVPLLGSAGSAALQMVGIGKPDVPDSQKP
PRNLGLTLYAAQNLNAANDNRPLALVVRLYALKDPTSFQQAPFDSFTDPAKEKTALGADLLSVREITLIP
GQRYNATEKVSREAQAFGVVALFRDPALQRWKLTFDPAKSEKSGIIIGLHNCAMTVTGGTVIPSQQGMPT
QRLDLLSSVNCG
 
Nucleotide Sequence: 879 bp     [Download]
>gi|83718394|ref|NC_007651.1|:3413202-3414080 Burkholderia thailandensis E264 chromosome I, complete sequence
GTGAAGAGCGGCCGTTTTAAAAGCAGTGCGGCGCGCCGCCTGACGCGCCACGCAAACTCCGGGGATCACC
GTGTACCGCTCCCATTGCAATTATTGCCGCAACGGAATTCGATTTCACTCAATCGGTGGAAAATTTTTCC
GAATAACACGGCATTGCCGGCAGTCATCCGGCATTTGAAGTCGCAGACGTTTTTGTGCAGCCAAATCGGC
AACGCAACTGATAGTTTTGACAGGGAGCAACGGGCGCCGCGCCCGGAAAAATCGATGAATCCGCTTGTGA
CTCGTTACGCGTTGCCGCTCGCCGCCTGCATTCTGCTCGGCGGCTGCGCGGCCGCCGTGCCGCTCCTCGG
TTCGGCGGGCAGCGCCGCGCTGCAGATGGTGGGCATCGGCAAGCCCGACGTGCCCGATTCGCAAAAGCCG
CCGCGCAATCTCGGCCTCACGCTCTACGCCGCGCAGAACCTCAACGCCGCGAACGACAACCGCCCGCTCG
CGCTTGTCGTGCGCCTCTACGCGCTGAAAGACCCGACGTCGTTCCAGCAGGCGCCGTTCGACAGCTTCAC
CGATCCAGCGAAAGAGAAGACCGCGCTCGGCGCCGATCTGCTGAGCGTGCGCGAAATCACGCTGATTCCC
GGACAGCGCTACAACGCGACAGAGAAGGTATCGCGCGAAGCGCAGGCATTCGGCGTCGTCGCGCTCTTTC
GCGACCCGGCGCTGCAGCGCTGGAAACTGACTTTCGATCCGGCGAAGTCCGAGAAATCCGGCATAATTAT
CGGCCTGCACAACTGCGCGATGACCGTGACGGGCGGCACCGTCATTCCTTCGCAGCAGGGCATGCCGACG
CAGCGGCTCGATTTGCTTTCGTCGGTGAACTGCGGGTGA