SecReT6
Protein ID: 83718754
SecReT6 ID115
T6SS typei4b
Gene symbol-
Locus tagBTH_I2956
StrainBurkholderia thailandensis E264
Repliconchromosome I [GenBank: NC_007651] [Browse all T6SS(s) in this replicon]
Location [Strand]3401194..3402129 [+]
ProductOmpA domain-containing protein
NoteTagL
UniProt IDQ2SUD6, Q2SUD6, Q2SUD6
KEGG IDbte:BTH_I2956
PDB IDNA
Domain hit(s) vs Pfam OmpA [PF00691], Evalue: 5.70E-26, Aligned region: 145..188
OmpA [PF00691], Evalue: 5.70E-26, Aligned region: 209..303
BON [PF04972], Evalue: 0.0028, Aligned region: 83..120
BON [PF04972], Evalue: 0.0028, Aligned region: 157..169
OmpA [PF00691], Evalue: 5.70E-26, Aligned region: 145..188
OmpA [PF00691], Evalue: 5.70E-26, Aligned region: 209..303
BON [PF04972], Evalue: 0.0028, Aligned region: 83..120
BON [PF04972], Evalue: 0.0028, Aligned region: 157..169
Protein Sequence: 311 a.a.     [Download]
>gi|83718754|ref|YP_443463.1| OmpA domain-containing protein [Burkholderia thailandensis E264]
MTKPRLPSRRASRFALTLAALALGGALGGAARADNVGPATVTPIDAGGVSVKSTPLAAPGAAANGTGTGA
IVSSPPPANAAPGQVVAGGKVADEATKAAVLQRLRDTYGAANVVDQIEVGNVATPPNWSANVQKLIGPQL
KQISKGQLKIDGTQIDVKGEVHNEAQRQQLASDMANALNPTYMIKNGLRVSASEQGLLDQTLANRTIEFE
TGSATLTPQGRTILDQMAGALAKMPNRTVEIIGHTDNSGNRASNIALSQSRADAVKGYLVTKGIASQQLT
TTGVGPDQPIASNDSADGRARNRRIEFRAGQ
 
Nucleotide Sequence: 936 bp     [Download]
>gi|83718394|ref|NC_007651.1|:3401194-3402129 Burkholderia thailandensis E264 chromosome I, complete sequence
ATGACGAAGCCGCGCCTGCCCTCCCGCCGCGCTTCCCGTTTCGCGCTCACGCTCGCCGCGCTCGCGCTCG
GCGGCGCGCTCGGCGGCGCCGCGCGCGCCGACAACGTCGGCCCCGCCACCGTCACGCCGATCGACGCGGG
CGGCGTATCCGTGAAATCGACGCCGCTCGCGGCGCCCGGCGCCGCGGCGAACGGCACGGGCACGGGCGCG
ATCGTGTCGTCGCCGCCGCCCGCGAACGCGGCTCCGGGCCAGGTCGTCGCCGGCGGCAAGGTCGCCGACG
AGGCGACGAAGGCCGCCGTGCTGCAGCGCCTGCGCGACACGTACGGCGCCGCGAACGTCGTCGACCAGAT
CGAAGTCGGCAACGTCGCGACGCCGCCGAACTGGTCCGCGAACGTCCAGAAGCTGATCGGCCCGCAACTG
AAGCAGATCAGCAAAGGACAGCTGAAGATCGACGGCACGCAGATCGACGTGAAGGGTGAGGTGCACAACG
AGGCGCAGCGGCAGCAGCTCGCGAGCGACATGGCCAACGCGCTGAACCCGACCTACATGATCAAGAACGG
GCTGCGCGTGAGCGCGTCCGAGCAGGGTCTGCTCGACCAGACGCTCGCGAACCGCACGATCGAGTTCGAG
ACCGGCAGCGCGACGCTCACGCCGCAAGGCCGCACGATCCTCGACCAGATGGCGGGCGCGCTCGCGAAGA
TGCCGAACCGGACGGTCGAGATCATCGGCCACACCGACAATTCGGGCAATCGCGCGTCGAACATCGCGCT
CAGCCAGTCGCGCGCGGACGCGGTGAAGGGCTACTTGGTGACGAAGGGCATCGCGTCGCAACAGCTGACG
ACGACGGGCGTCGGCCCCGACCAGCCGATCGCGTCGAACGACTCGGCCGACGGGCGCGCGCGCAATCGCC
GGATCGAGTTCCGCGCGGGGCAGTAA