SecReT6
Protein ID: 83718946
SecReT6 ID115
T6SS typei4b
Gene symbol-
Locus tagBTH_I2957
StrainBurkholderia thailandensis E264
Repliconchromosome I [GenBank: NC_007651] [Browse all T6SS(s) in this replicon]
Location [Strand]3402329..3403438 [-]
ProductImpA-like N-terminal family protein
NoteTssA
UniProt IDQ2SUD5
KEGG IDbte:BTH_I2957
PDB IDNA
Domain hit(s) vs Pfam ImpA-rel_N [PF06812], Evalue: 4.60E-24, Aligned region: 48..109
Protein Sequence: 369 a.a.     [Download]
>gi|83718946|ref|YP_443464.1| ImpA-like N-terminal family protein [Burkholderia thailandensis E264]
MLTPISEASPCGDDLLFSAEFDAIQHARKFDDPSLDQGEWITDIKEADWGFVVEQSSTLLRERTKDLRLA
VWLTEALALEDGIGGLTQGYELLTNLCRQFWDHVHPLPDGDDAEYRLGNVAWLAGRTVALLRAVPLTDGA
SNAFSELDWDVAQHVAQAIRRDPEQANEIARGKPSVEQIEASKRMTPVAFYARLLGELKTFQAALDALEQ
ELDQRAGDAAPSFRQARDAYETVYRLAERFAKEQGYSADAQPRGVAPNAQDASRERAEPSFRTPLHSEEP
VQRHAHAPSAPAPIVIAGIQNRAQAVEQLRAVAKYFRGTEPHSPVAYLADKAAEWADMPLHQWLASVVKD
DGSLAHIRELLGLKPDDNA
 
Nucleotide Sequence: 1110 bp     [Download]
>gi|83718394|ref|NC_007651.1|:c3403438-3402329 Burkholderia thailandensis E264 chromosome I, complete sequence
TTGCTGACGCCGATCAGCGAAGCGTCGCCTTGCGGCGACGATCTCCTGTTCTCCGCCGAATTCGACGCGA
TCCAGCACGCGCGCAAGTTCGACGATCCGTCGCTCGACCAGGGCGAATGGATCACCGACATCAAGGAGGC
GGACTGGGGCTTCGTCGTCGAGCAATCGAGCACGCTGTTGCGCGAGCGCACCAAGGACCTGCGGCTCGCC
GTATGGCTGACCGAGGCGCTCGCGCTCGAGGACGGCATCGGCGGGCTCACGCAGGGCTACGAACTGCTCA
CGAACCTCTGCCGGCAATTCTGGGATCACGTACACCCGCTGCCGGACGGCGACGATGCCGAATACCGGCT
CGGCAACGTCGCGTGGCTCGCCGGGCGCACGGTCGCGCTGCTGCGCGCGGTGCCGCTTACCGACGGCGCG
TCGAACGCGTTCAGCGAGCTCGACTGGGACGTTGCGCAACACGTCGCGCAGGCGATCCGGCGCGATCCCG
AGCAGGCGAACGAGATCGCGCGCGGCAAGCCGTCGGTCGAGCAGATCGAGGCGTCGAAGCGGATGACACC
CGTTGCGTTCTACGCGCGGCTGCTCGGCGAACTGAAAACGTTCCAGGCGGCGCTCGACGCGCTCGAGCAG
GAACTCGACCAACGCGCGGGCGACGCGGCGCCGAGCTTCCGTCAGGCGCGCGATGCGTACGAAACCGTCT
ACCGGCTTGCCGAGCGTTTCGCGAAGGAGCAGGGCTACTCGGCCGATGCGCAGCCGCGGGGCGTCGCGCC
GAATGCGCAGGACGCATCGCGCGAGCGCGCGGAGCCGAGCTTCAGGACGCCGCTTCATTCGGAGGAACCC
GTGCAGAGACACGCACACGCGCCGTCCGCGCCCGCGCCGATCGTGATCGCCGGCATCCAGAATCGCGCGC
AAGCGGTCGAGCAACTGCGCGCGGTCGCAAAGTATTTTCGCGGAACCGAGCCGCACAGCCCGGTTGCGTA
TCTCGCCGACAAGGCGGCAGAGTGGGCCGACATGCCGCTGCATCAATGGCTCGCGTCGGTCGTCAAGGAC
GACGGCTCGCTCGCGCATATCCGCGAGCTGCTCGGCCTGAAGCCGGACGACAACGCGTGA