SecReT6
Protein ID: 83719151
SecReT6 ID115
T6SS typei4b
Gene symbol-
Locus tagBTH_I2960
StrainBurkholderia thailandensis E264
Repliconchromosome I [GenBank: NC_007651] [Browse all T6SS(s) in this replicon]
Location [Strand]3407306..3409144 [-]
Producthypothetical protein
NoteTssF
UniProt IDQ2SUD2
KEGG IDbte:BTH_I2960
PDB IDNA
Domain hit(s) vs Pfam DUF879 [PF05947], Evalue: 3.20E-213, Aligned region: 4..611
Protein Sequence: 612 a.a.     [Download]
>gi|83719151|ref|YP_443467.1| hypothetical protein BTH_I2960 [Burkholderia thailandensis E264]
MEELLPYYERELSFLRRYSLEFANRYPKIAARLAQTGEHCEDPHVERMIESFALLGARINKKLDDEYPEF
TEALVEVLYPHYLRPFPSCSIAQFGASHAFAELTEPQVVERGTELKSRAIRGVQCRFRTAYDVTLAPIRL
ADARYGSIAAAPAAAALPGNATGVISITFESTSPQLDLAALKLGKLRAHLHGEQSFVAALTDCLFAHALA
CYVEPDRSGRWIALGKTPFEHAGFDETDALIDYPARSHPAYRLLTEYFAFPDKFNFVDFDLGVLARRAGH
CRQLTLHVALRDVRSDSHVARLLDLLSASHFRLFCTPVVNLFRQHGEPIRVDHRAVSYPVIGDARRAFAY
EVYSIDSVHLVRQRADRETVVEFRSFYSLHHGEAAQAGHYWFARRNDDVARKSPGYETEISIVDVDFEPG
APQTDTLSLDLTCTNRDLPAALATGLDGGDLFIDGGAQPGPIALLRRPTPSARFERGHAAHWRLVSHLAL
NHVSLAEEGLAALKEVLVLYDLRRSAVSTRHIDGIVGIEQKSAVQWLPGKPFATFVRGVEIRLAIDDEHF
VGSSLATFVRMIDAFFGLYVHLNSFVQLIVVSKRTGEEIMRCKPRSGESILA
 
Nucleotide Sequence: 1839 bp     [Download]
>gi|83718394|ref|NC_007651.1|:c3409144-3407306 Burkholderia thailandensis E264 chromosome I, complete sequence
ATGGAAGAGTTGTTGCCGTATTACGAACGCGAACTGTCGTTTCTGCGGCGCTATTCGCTCGAATTCGCGA
ACCGGTACCCGAAGATCGCCGCGCGCCTCGCGCAGACGGGCGAGCACTGCGAAGACCCGCACGTCGAGCG
GATGATCGAATCGTTCGCGCTGCTCGGCGCGCGGATCAACAAGAAGCTCGACGACGAGTATCCCGAATTC
ACCGAAGCGCTTGTCGAAGTCCTCTATCCGCATTATTTGCGGCCGTTCCCTTCATGCTCGATCGCGCAGT
TCGGCGCGTCGCATGCGTTCGCCGAACTGACCGAGCCGCAGGTCGTCGAGCGCGGCACCGAGTTGAAGAG
CCGCGCGATTCGAGGCGTGCAGTGCCGGTTCCGCACCGCGTACGACGTGACGCTCGCGCCGATTCGGCTC
GCCGATGCCCGCTACGGATCGATCGCCGCGGCGCCCGCCGCGGCCGCGCTGCCCGGCAACGCGACAGGCG
TGATCTCGATCACGTTCGAATCGACGTCGCCGCAGCTCGACCTTGCGGCGCTGAAGCTCGGCAAGCTGCG
CGCGCATCTGCACGGCGAGCAGTCGTTCGTCGCCGCACTGACTGATTGCCTGTTCGCGCACGCGCTCGCC
TGCTACGTCGAGCCCGATCGCAGCGGCCGCTGGATCGCGCTCGGCAAGACACCGTTCGAGCACGCGGGAT
TCGACGAGACCGACGCGCTGATCGACTATCCTGCCCGTTCGCACCCGGCCTATAGGCTGCTGACCGAATA
CTTCGCATTCCCGGACAAATTCAACTTTGTCGACTTCGACCTGGGCGTGCTCGCGCGGCGCGCCGGGCAT
TGCCGGCAACTGACGCTGCACGTCGCGCTGCGCGACGTGCGCAGCGATTCGCACGTCGCGCGGCTGCTCG
ATCTGTTGAGCGCGAGCCACTTTCGGCTGTTCTGCACGCCGGTCGTGAACCTGTTCCGCCAGCACGGCGA
GCCGATCCGGGTCGACCATCGGGCGGTGTCTTATCCGGTGATCGGCGATGCGCGCCGCGCGTTCGCGTAC
GAGGTTTATTCGATCGATTCGGTGCACCTCGTGCGGCAGCGCGCGGATCGCGAAACGGTTGTCGAGTTTC
GGTCGTTCTACTCGCTGCATCACGGCGAGGCGGCGCAGGCCGGCCACTACTGGTTCGCGCGCCGCAACGA
CGATGTCGCGCGCAAGAGCCCCGGCTATGAGACCGAGATTTCGATCGTCGATGTCGATTTCGAGCCGGGC
GCGCCGCAGACCGACACGCTGAGCCTCGACCTCACCTGCACGAACCGCGATTTGCCCGCGGCGCTCGCGA
CCGGGCTCGACGGCGGCGATCTCTTCATCGACGGCGGCGCGCAGCCCGGCCCGATCGCGCTGCTGCGCCG
GCCGACGCCGAGCGCGCGCTTCGAGCGCGGCCACGCCGCGCACTGGCGGCTCGTGTCGCATCTCGCGCTC
AATCACGTTTCGCTTGCCGAAGAGGGGCTCGCCGCGCTGAAGGAGGTGCTCGTGCTGTACGATCTGAGAC
GTTCCGCTGTGTCGACGCGGCACATCGACGGGATCGTCGGCATCGAGCAGAAGAGTGCCGTGCAGTGGCT
GCCGGGCAAGCCGTTCGCGACGTTCGTGCGCGGCGTCGAGATCCGGCTCGCGATCGACGACGAGCATTTC
GTCGGTTCGAGCCTCGCGACGTTCGTGCGGATGATCGACGCATTCTTCGGACTGTACGTGCACCTCAACA
GCTTTGTTCAACTGATCGTCGTGTCCAAGCGCACCGGCGAGGAGATCATGCGATGCAAACCGCGCAGCGG
CGAATCGATCCTGGCGTAG