SecReT6
Protein ID: 83719260
SecReT6 ID115
T6SS typei4b
Gene symbol-
Locus tagBTH_I2964
StrainBurkholderia thailandensis E264
Repliconchromosome I [GenBank: NC_007651] [Browse all T6SS(s) in this replicon]
Location [Strand]3411848..3412366 [-]
ProductEvpA
NoteTssB
UniProt IDQ2SUC8
KEGG IDbte:BTH_I2964
PDB IDNA
Domain hit(s) vs Pfam DUF770 [PF05591], Evalue: 7.60E-59, Aligned region: 11..163
Protein Sequence: 172 a.a.     [Download]
>gi|83719260|ref|YP_443471.1| EvpA [Burkholderia thailandensis E264]
MAKKESIQKRLQKVRPPRVQLTYEVERGDAIEIKELPFVVGVVGDLAGQSEVEQPKLRDRKFVNIDRDNF
DDVMKAIEPRATFQVENRLSDAGGKFAVDLKFRSINDFNPDEVVGQVEPLRRLLEARSKLADLRNKLAGN
DKLEDLLSEVLSNTQQLEALKKGADGGDKQGE
 
Nucleotide Sequence: 519 bp     [Download]
>gi|83718394|ref|NC_007651.1|:c3412366-3411848 Burkholderia thailandensis E264 chromosome I, complete sequence
ATGGCGAAGAAAGAAAGCATTCAAAAGCGCTTGCAGAAAGTGCGGCCGCCCCGCGTCCAGCTCACGTACG
AAGTCGAACGGGGCGACGCGATCGAGATCAAGGAATTGCCGTTCGTCGTCGGGGTCGTCGGCGATCTGGC
GGGGCAGTCGGAAGTCGAGCAGCCGAAGCTGCGCGATCGCAAGTTCGTCAACATCGACCGCGACAACTTC
GACGACGTGATGAAGGCGATCGAGCCGCGCGCCACGTTCCAGGTGGAGAACCGTCTGAGCGACGCGGGCG
GCAAGTTCGCGGTCGATCTGAAGTTCCGATCGATCAACGATTTCAATCCGGACGAGGTCGTCGGGCAGGT
CGAGCCGTTGCGGCGCCTGCTCGAGGCGCGATCGAAGCTCGCTGACCTGCGCAACAAGCTGGCCGGCAAC
GACAAGCTCGAAGACCTGCTGAGCGAAGTGCTGTCGAACACGCAGCAGCTCGAAGCGCTGAAGAAGGGCG
CGGACGGCGGCGACAAGCAGGGCGAATGA