SecReT6
Protein ID: 83719347
SecReT6 ID115
T6SS typei4b
Gene symbol-
Locus tagBTH_I2967
StrainBurkholderia thailandensis E264
Repliconchromosome I [GenBank: NC_007651] [Browse all T6SS(s) in this replicon]
Location [Strand]3414189..3415535 [+]
Producthypothetical protein
NoteTssK
UniProt IDQ2SUC5
KEGG IDbte:BTH_I2967
PDB IDNA
Domain hit(s) vs Pfam DUF876 [PF05936], Evalue: 5.70E-135, Aligned region: 19..446
Protein Sequence: 448 a.a.     [Download]
>gi|83719347|ref|YP_443474.1| hypothetical protein BTH_I2967 [Burkholderia thailandensis E264]
MSYSAKVLWGEGLFLRPQHFQRQDAYHEARLFESIQAIQPYNWGVRSVRFDRDALGSNVLRASELSLVFP
DGALYSAPQADELPPPIALDTLPEGINEFTFYLALHPLRETGSNYADSRDTGFVSRFVSEQASVADHFTD
AAEADIMFLKTNVKLIAHSEPRDQLLSIPLVRVRRTATSGFEIDDSFVPPCLAIEASPILHQRLRQLIDA
LQAKVNALYGFHREPTKNIIEFRSGDIASFWLLHTASAAFATLAHLHQHSALHPERLFQELLRLAGQLMT
FSKGYVLADLPAYRHDDPGPGFARLDSILRDLLETVISTRYFAITLEEVRPSFHVGRLDSGKIDDKTAFY
LAVSADMPSVELVDAVPARFKVGAPDDVDKLVLSAMPGVRLAYTPQVPPAIPVRPGACYFALDARSPLYE
RMLQAQSAMIYAPSGINDLKFELIAVTS
 
Nucleotide Sequence: 1347 bp     [Download]
>gi|83718394|ref|NC_007651.1|:3414189-3415535 Burkholderia thailandensis E264 chromosome I, complete sequence
ATGAGTTATTCGGCCAAGGTGCTCTGGGGGGAAGGCCTCTTTCTGAGGCCGCAGCACTTTCAGCGGCAGG
ACGCATACCACGAAGCGCGCCTGTTCGAATCGATTCAGGCGATCCAGCCGTACAACTGGGGCGTGCGTTC
GGTGCGGTTCGATCGCGACGCACTCGGCAGCAACGTGCTGCGCGCGAGCGAACTGTCGCTCGTGTTCCCG
GACGGCGCGCTCTACTCCGCGCCGCAAGCCGATGAATTGCCGCCGCCCATCGCGCTCGACACGCTGCCCG
AAGGCATCAACGAATTCACGTTCTATCTCGCATTGCACCCGCTGCGCGAAACCGGCTCGAACTACGCGGA
CAGCCGCGACACCGGCTTCGTGTCGCGCTTCGTCAGCGAGCAGGCGAGCGTCGCCGATCATTTCACCGAC
GCCGCCGAAGCCGACATCATGTTCCTGAAGACGAACGTGAAGCTGATCGCGCACAGCGAGCCGCGCGACC
AATTGCTGTCGATCCCGCTCGTGCGCGTGCGGCGCACCGCGACGTCCGGCTTCGAGATCGACGACAGCTT
CGTGCCGCCGTGCCTCGCGATCGAGGCGTCGCCGATCCTGCATCAACGCCTGCGGCAGCTGATCGACGCG
TTGCAGGCGAAAGTGAATGCGCTGTACGGCTTCCATCGCGAACCGACGAAGAACATCATCGAATTCCGAT
CGGGCGACATCGCATCATTCTGGCTGCTGCATACGGCAAGCGCCGCGTTCGCGACGCTCGCGCACCTGCA
TCAGCATTCGGCGCTCCATCCGGAGCGGCTGTTCCAGGAACTGCTGCGCCTCGCGGGCCAGTTGATGACG
TTCTCGAAGGGCTACGTGCTCGCCGATCTGCCCGCGTACCGGCACGACGATCCGGGCCCGGGCTTCGCGC
GCCTCGATTCGATCCTGCGCGACCTGCTCGAAACCGTGATCTCGACGCGCTACTTCGCGATCACGCTCGA
GGAAGTGCGGCCGTCGTTCCATGTCGGGCGGCTCGATTCGGGCAAGATCGACGACAAGACCGCGTTCTAT
CTCGCTGTGTCGGCCGACATGCCGTCGGTCGAGCTCGTCGATGCCGTGCCCGCGCGCTTCAAGGTCGGCG
CGCCGGACGACGTCGACAAGCTCGTGCTGTCCGCGATGCCCGGCGTGCGCCTTGCGTATACGCCGCAGGT
GCCGCCCGCGATCCCCGTGCGCCCGGGCGCATGCTATTTCGCACTCGATGCGCGCAGCCCGCTCTATGAG
CGGATGCTGCAGGCCCAGTCGGCGATGATCTATGCGCCGTCCGGAATCAACGATCTCAAATTCGAACTGA
TCGCCGTCACCTCATGA