SecReT6
Protein ID: 83719917
SecReT6 ID115
T6SS typei4b
Gene symbol-
Locus tagBTH_I2961
StrainBurkholderia thailandensis E264
Repliconchromosome I [GenBank: NC_007651] [Browse all T6SS(s) in this replicon]
Location [Strand]3409225..3409707 [-]
Producthypothetical protein
NoteTssE
UniProt IDQ2SUD1
KEGG IDbte:BTH_I2961
PDB IDNA
Domain hit(s) vs Pfam GPW_gp25 [PF04965], Evalue: 3.90E-22, Aligned region: 29..137
Protein Sequence: 160 a.a.     [Download]
>gi|83719917|ref|YP_443468.1| hypothetical protein BTH_I2961 [Burkholderia thailandensis E264]
MKRFEPSFLDKLFDDEPHVPAPAAMRQLSLEELKNTVARDVEAILNTRIALTEEDLAALPECQRSVLTYG
LNDFAGLSLASHYDRTFICKSIQQAIARHEPRLQQVQVTFELNEQSTNALYFAIQALLVVHPAEEPVTFD
AMLQPSTLQYSVTRSRAAKV
 
Nucleotide Sequence: 483 bp     [Download]
>gi|83718394|ref|NC_007651.1|:c3409707-3409225 Burkholderia thailandensis E264 chromosome I, complete sequence
ATGAAACGCTTCGAACCGAGCTTCCTCGACAAGCTGTTCGACGACGAACCGCATGTGCCGGCGCCCGCCG
CGATGCGGCAATTGTCGCTGGAGGAACTGAAGAACACGGTCGCGCGCGACGTCGAGGCGATCCTCAACAC
GCGCATCGCGCTGACCGAAGAAGATCTCGCCGCGCTGCCGGAATGCCAGCGCTCGGTGCTGACTTACGGG
CTGAACGACTTCGCCGGCCTGAGCCTCGCGAGCCACTACGACCGCACGTTCATCTGCAAGTCGATTCAGC
AGGCGATCGCGCGGCACGAGCCGAGGCTGCAGCAGGTGCAGGTGACGTTCGAGCTGAACGAGCAGTCGAC
GAACGCGCTCTATTTCGCGATCCAGGCGCTGCTCGTCGTGCATCCCGCCGAGGAGCCGGTGACCTTCGAT
GCGATGCTGCAGCCGTCGACGTTGCAATACTCGGTGACGCGCTCGCGCGCCGCCAAGGTGTGA