SecReT6
Protein ID: 83720142
SecReT6 ID115
T6SS typei4b
Gene symbol-
Locus tagBTH_I2958
StrainBurkholderia thailandensis E264
Repliconchromosome I [GenBank: NC_007651] [Browse all T6SS(s) in this replicon]
Location [Strand]3403545..3406208 [-]
ProductClpA/B type protease
NoteTssH
UniProt IDQ2SUD4
KEGG IDbte:BTH_I2958
PDB IDNA
Domain hit(s) vs Pfam AAA_2 [PF07724], Evalue: 2.10E-44, Aligned region: 229..328
AAA_2 [PF07724], Evalue: 2.10E-44, Aligned region: 617..785
AAA [PF00004], Evalue: 4.40E-19, Aligned region: 230..342
AAA [PF00004], Evalue: 4.40E-19, Aligned region: 622..715
ClpB_D2-small [PF10431], Evalue: 4.50E-13, Aligned region: 792..864
AAA_5 [PF07728], Evalue: 1.20E-12, Aligned region: 230..248
AAA_5 [PF07728], Evalue: 1.20E-12, Aligned region: 304..360
AAA_5 [PF07728], Evalue: 1.20E-12, Aligned region: 621..740
Clp_N [PF02861], Evalue: 1.20E-12, Aligned region: 27..74
Clp_N [PF02861], Evalue: 1.20E-12, Aligned region: 114..133
AAA_16 [PF13191], Evalue: 1.30E-10, Aligned region: 54..77
AAA_16 [PF13191], Evalue: 1.30E-10, Aligned region: 207..253
AAA_16 [PF13191], Evalue: 1.30E-10, Aligned region: 274..308
AAA_16 [PF13191], Evalue: 1.30E-10, Aligned region: 456..471
AAA_16 [PF13191], Evalue: 1.30E-10, Aligned region: 601..657
AAA_16 [PF13191], Evalue: 1.30E-10, Aligned region: 688..710
AAA_16 [PF13191], Evalue: 1.30E-10, Aligned region: 787..875
AAA_22 [PF13401], Evalue: 6.40E-07, Aligned region: 230..316
AAA_22 [PF13401], Evalue: 6.40E-07, Aligned region: 618..642
AAA_22 [PF13401], Evalue: 6.40E-07, Aligned region: 683..715
Sigma54_activat [PF00158], Evalue: 3.80E-06, Aligned region: 212..248
Sigma54_activat [PF00158], Evalue: 3.80E-06, Aligned region: 619..736
IstB_IS21 [PF01695], Evalue: 0.00013, Aligned region: 221..252
IstB_IS21 [PF01695], Evalue: 0.00013, Aligned region: 621..639
IstB_IS21 [PF01695], Evalue: 0.00013, Aligned region: 796..832
AAA_17 [PF13207], Evalue: 0.00034, Aligned region: 67..106
AAA_17 [PF13207], Evalue: 0.00034, Aligned region: 231..300
AAA_17 [PF13207], Evalue: 0.00034, Aligned region: 621..656
AAA_29 [PF13555], Evalue: 0.00041, Aligned region: 222..246
AAA_29 [PF13555], Evalue: 0.00041, Aligned region: 617..647
Zeta_toxin [PF06414], Evalue: 0.00052, Aligned region: 128..154
Zeta_toxin [PF06414], Evalue: 0.00052, Aligned region: 229..250
Zeta_toxin [PF06414], Evalue: 0.00052, Aligned region: 611..661
AAA_14 [PF13173], Evalue: 0.00056, Aligned region: 230..363
AAA_14 [PF13173], Evalue: 0.00056, Aligned region: 620..702
Arch_ATPase [PF01637], Evalue: 0.00093, Aligned region: 209..244
Arch_ATPase [PF01637], Evalue: 0.00093, Aligned region: 282..366
Arch_ATPase [PF01637], Evalue: 0.00093, Aligned region: 619..660
Arch_ATPase [PF01637], Evalue: 0.00093, Aligned region: 692..715
AAA_30 [PF13604], Evalue: 0.0011, Aligned region: 16..40
AAA_30 [PF13604], Evalue: 0.0011, Aligned region: 215..307
AAA_30 [PF13604], Evalue: 0.0011, Aligned region: 617..647
AAA_19 [PF13245], Evalue: 0.0013, Aligned region: 228..252
AAA_19 [PF13245], Evalue: 0.0013, Aligned region: 618..643
NACHT [PF05729], Evalue: 0.0014, Aligned region: 230..257
NACHT [PF05729], Evalue: 0.0014, Aligned region: 622..641
SRP54 [PF00448], Evalue: 0.0017, Aligned region: 230..251
SRP54 [PF00448], Evalue: 0.0017, Aligned region: 620..652
MobB [PF03205], Evalue: 0.0047, Aligned region: 231..255
MobB [PF03205], Evalue: 0.0047, Aligned region: 620..653
RNA_helicase [PF00910], Evalue: 0.008, Aligned region: 231..251
RNA_helicase [PF00910], Evalue: 0.008, Aligned region: 622..643
Protein Sequence: 887 a.a.     [Download]
>gi|83720142|ref|YP_443465.1| ClpA/B type protease [Burkholderia thailandensis E264]
MSTPLKTLIAKLNPVCRKAAERAASHCFARGHYEVDLEHLFLALLDESTGDVPLVLRASGVDPHALRADL
ERELEGLKAGNTRTPVFSVHLTELFEQAWLIASLDSQIGRIRSGHLLLALLTGPDLAQFAQRMSPQFARV
RIDDLKHKFDEITAGSIETEPRQAEADIAVPDGAAADSPRGPSKTPALDTYTTNLTQRASEGKIDPVIGR
DAEIRQAIDILMRRRQNNPIMTGEAGVGKTAVVEGLALKIAADDVPPPLSGVALHVLDMGLLQAGASVKG
EFENRLKSVIDEVKKSAHPIILFIDEAHTIIGAGGQAGQNDAANLLKPALARGELRTIAATTWSEYKKYF
EKDAALARRFQVVKIDEPSEPLAAAMLRGMAGLMEQHFNVRILDNAITEAVRLSHRYISGRQLPDKAISV
LDTACAKVALAHSATPAAIDDAKKRIERIDAEIAALEREAASGAAHDERLAELRAEREADLKALAEDEAR
YEEERALVTEIGALRAELDAAREPSADGRPADIDATRAKLAERVDALRALQGNQPMVPLQVDGHVIAEIV
ASWTGIPLGRMVKDEIETVLNLRDLLGARVIGQDHALDAIAQRVRTATANLEDPNKPRGVFMFVGPSGVG
KTETALALADVLYGGERKMITINMSEYQEAHSVSGLKGSPPGYVGYGEGGVLTEAVRRNPYSVVLLDEVE
KAHPDVLEMFFQVFDKGAMDDAEGREIDFRNTLIILTSNVGSPAVMQACLNKTQEELPDAETLAETLRPQ
LYKTFKPAFLGRMKVIPYYPISDDVLAEIIELKLERIRRRIEANHKAAFEWDESLVDAVLARCTEVDSGA
RNVDHILNGTLLPEIAEHVLSRIADGEAIARIAARAAETGEFEYTVE
 
Nucleotide Sequence: 2664 bp     [Download]
>gi|83718394|ref|NC_007651.1|:c3406208-3403545 Burkholderia thailandensis E264 chromosome I, complete sequence
ATGAGCACGCCCCTGAAGACCCTGATCGCGAAACTGAATCCGGTGTGCCGGAAGGCCGCCGAACGCGCCG
CCAGCCATTGCTTCGCACGCGGTCACTACGAAGTGGATCTCGAGCACTTGTTTCTCGCGCTGCTCGACGA
ATCGACCGGAGACGTGCCGCTCGTGTTGCGCGCGAGCGGCGTCGATCCGCACGCGCTGCGCGCGGACCTC
GAGCGCGAGCTTGAAGGCCTGAAGGCGGGCAACACGCGTACGCCGGTGTTCTCGGTGCATCTGACCGAGC
TGTTCGAGCAGGCGTGGCTCATCGCGTCGCTCGATTCGCAGATCGGACGGATTCGCTCGGGCCACCTGCT
GCTCGCGCTGCTGACGGGGCCGGATCTCGCGCAGTTCGCGCAGCGGATGTCGCCGCAGTTCGCGCGCGTG
AGAATCGATGACCTGAAGCACAAGTTCGACGAGATCACGGCGGGCTCGATCGAGACCGAGCCGCGACAAG
CGGAAGCCGACATCGCGGTGCCGGACGGCGCGGCGGCGGACTCGCCGCGCGGCCCGTCGAAGACGCCGGC
GCTCGACACGTATACGACGAACCTCACGCAGCGCGCGAGCGAAGGCAAGATCGATCCGGTGATCGGCCGC
GACGCGGAGATTCGCCAGGCGATCGACATCCTGATGCGCCGCCGGCAGAACAATCCGATCATGACGGGTG
AGGCGGGCGTCGGCAAGACGGCCGTCGTCGAAGGGCTCGCGCTGAAGATCGCGGCCGACGACGTGCCGCC
GCCGCTTTCCGGCGTCGCGTTGCACGTGCTCGACATGGGTTTGCTGCAGGCGGGCGCAAGCGTGAAGGGC
GAGTTCGAGAATCGCCTGAAGAGCGTGATCGACGAAGTGAAGAAGAGCGCGCACCCGATCATCCTCTTCA
TCGACGAAGCGCACACGATCATCGGCGCGGGCGGGCAGGCCGGCCAGAACGACGCGGCTAACCTGCTGAA
GCCGGCGCTCGCGCGCGGCGAGCTGCGCACGATCGCGGCGACCACGTGGAGCGAATACAAGAAGTACTTC
GAGAAGGATGCGGCGCTCGCGCGGCGCTTCCAGGTCGTGAAGATCGACGAGCCGAGCGAGCCGCTCGCCG
CCGCGATGCTGCGCGGGATGGCGGGGCTGATGGAGCAGCACTTCAACGTACGCATTCTCGACAATGCGAT
CACCGAGGCGGTGCGGCTGTCGCATCGCTACATCAGCGGCCGCCAACTGCCCGACAAGGCGATCAGCGTG
CTCGACACCGCGTGCGCGAAGGTCGCGCTCGCGCACAGCGCGACGCCCGCCGCAATCGACGACGCGAAGA
AGCGCATCGAGCGGATCGACGCGGAGATCGCGGCGCTCGAGCGTGAAGCCGCGAGCGGCGCCGCGCATGA
CGAGCGCCTTGCCGAGCTGCGCGCCGAGCGCGAGGCCGATCTGAAGGCGCTGGCCGAAGACGAGGCGCGC
TACGAAGAGGAGCGCGCGCTCGTGACCGAAATCGGCGCGCTGCGCGCCGAGCTCGACGCCGCGCGCGAGC
CGTCGGCCGACGGTCGGCCGGCCGACATCGACGCGACGCGCGCGAAGCTCGCCGAGCGCGTCGATGCGTT
GCGTGCGCTGCAGGGCAACCAGCCGATGGTGCCGCTGCAGGTCGATGGCCACGTCATTGCGGAAATCGTC
GCGTCGTGGACGGGCATTCCGCTCGGACGAATGGTGAAGGACGAGATCGAGACCGTGCTCAATCTGCGCG
ATCTGCTCGGTGCGCGCGTGATCGGCCAGGACCACGCGCTCGACGCGATCGCGCAGCGCGTGCGCACCGC
GACCGCGAACCTCGAGGACCCGAACAAGCCGCGTGGCGTGTTCATGTTCGTCGGGCCGTCGGGCGTCGGC
AAGACCGAGACCGCGCTTGCGCTTGCAGACGTGCTGTACGGCGGCGAACGCAAGATGATCACGATCAACA
TGAGCGAGTATCAGGAGGCGCACAGCGTGTCGGGCCTGAAGGGCTCGCCGCCCGGTTACGTCGGCTACGG
CGAGGGCGGCGTGCTGACGGAGGCGGTGCGCCGCAATCCGTACTCGGTCGTGCTGCTCGACGAAGTCGAG
AAGGCGCATCCGGATGTGCTCGAAATGTTCTTCCAGGTGTTTGACAAGGGCGCGATGGACGACGCCGAAG
GCCGCGAGATCGACTTCCGCAATACGCTGATCATCCTGACGTCGAACGTCGGCTCGCCGGCGGTGATGCA
GGCGTGCCTGAACAAGACGCAGGAAGAGCTGCCCGATGCCGAGACGCTTGCCGAGACGCTGCGCCCGCAA
CTCTACAAGACCTTCAAGCCCGCGTTCCTCGGCCGCATGAAGGTGATTCCGTACTATCCGATCTCCGACG
ACGTGCTCGCCGAGATCATCGAGCTGAAACTCGAACGGATTCGCCGCCGGATCGAAGCGAACCACAAGGC
CGCGTTCGAATGGGACGAGTCGCTTGTCGACGCCGTGCTCGCGCGCTGCACCGAAGTCGATTCGGGCGCG
CGCAACGTCGATCACATCCTGAACGGCACGCTGCTGCCCGAGATCGCCGAGCACGTGCTGTCGCGGATCG
CCGACGGCGAGGCGATCGCGCGGATCGCCGCGCGCGCGGCCGAGACGGGCGAGTTCGAGTACACGGTCGA
GTAA