SecReT6
Protein ID: 83720562
SecReT6 ID115
T6SS typei4b
Gene symbol-
Locus tagBTH_I2968
StrainBurkholderia thailandensis E264
Repliconchromosome I [GenBank: NC_007651] [Browse all T6SS(s) in this replicon]
Location [Strand]3415532..3416317 [+]
ProductompA family protein
NoteTssL
UniProt IDQ2SUC4
KEGG IDbte:BTH_I2968
PDB IDNA
Domain hit(s) vs Pfam DUF2077 [PF09850], Evalue: 3.20E-57, Aligned region: 31..232
Protein Sequence: 261 a.a.     [Download]
>gi|83720562|ref|YP_443475.1| ompA family protein [Burkholderia thailandensis E264]
MSYAPSLFGGNTPPPAPHTVSSTDAGFQARSLVDLLYDGFFMLFLLKNGREPNDASEFSTRIQEFLGEFE
RGAKKLNIAADDVYAAKFAFCAAIDESVLSSQFKIRADWERRPLQLVLFGEQLAGEKFYQYLEECRAQGA
ARLQSLEVFHMCLLLGFQGKYLLEGPEKLAYLTARLGDEIANMKGKRAPFAPHWPLPDQISHRLKREVPL
WAIGAVFALVGLLAFVGLNTYLKDSTVRALAPYSQVIKVGPESANLTISLP
 
Nucleotide Sequence: 786 bp     [Download]
>gi|83718394|ref|NC_007651.1|:3415532-3416317 Burkholderia thailandensis E264 chromosome I, complete sequence
ATGAGTTACGCGCCTTCCCTCTTCGGCGGCAACACGCCGCCTCCCGCGCCGCACACGGTGTCGTCGACCG
ACGCCGGCTTCCAGGCACGCTCGCTCGTCGATCTGCTGTACGACGGCTTCTTCATGCTGTTCCTGCTGAA
GAACGGCCGCGAACCGAACGACGCGTCGGAATTCAGCACGCGCATTCAGGAGTTCCTGGGCGAATTCGAG
CGCGGCGCGAAGAAGCTCAACATCGCCGCCGACGACGTCTACGCGGCGAAGTTCGCGTTTTGCGCGGCGA
TCGACGAATCGGTGCTGTCGTCGCAGTTCAAGATCCGCGCGGATTGGGAACGCCGGCCGCTGCAACTCGT
GCTGTTCGGCGAACAGCTTGCGGGCGAGAAGTTCTATCAGTACCTCGAAGAATGCCGCGCGCAGGGCGCG
GCACGGCTGCAGTCGCTCGAGGTGTTCCATATGTGCCTGCTGCTCGGCTTCCAGGGCAAGTATCTGCTCG
AAGGGCCGGAGAAGCTCGCGTATCTGACCGCGCGGCTCGGCGACGAGATCGCGAACATGAAGGGCAAGCG
CGCGCCGTTCGCGCCGCATTGGCCACTTCCGGATCAGATCTCGCACCGGCTCAAGCGCGAGGTGCCGCTG
TGGGCGATCGGGGCGGTGTTCGCGCTCGTCGGGCTGCTGGCGTTCGTCGGGTTGAATACGTATTTGAAGG
ACAGCACCGTGCGGGCGCTCGCGCCTTATTCGCAGGTCATCAAGGTTGGGCCGGAGTCGGCTAATTTGAC
GATTTCGTTGCCTTGA