SecReT6
Protein ID: 83720854
SecReT6 ID115
T6SS typei4b
Gene symbol-
Locus tagBTH_I2959
StrainBurkholderia thailandensis E264
Repliconchromosome I [GenBank: NC_007651] [Browse all T6SS(s) in this replicon]
Location [Strand]3406242..3407342 [-]
Producthypothetical protein
NoteTssG
UniProt IDQ2SUD3
KEGG IDbte:BTH_I2959
PDB IDNA
Domain hit(s) vs Pfam DUF1305 [PF06996], Evalue: 2.00E-94, Aligned region: 18..347
Protein Sequence: 366 a.a.     [Download]
>gi|83720854|ref|YP_443466.1| hypothetical protein BTH_I2959 [Burkholderia thailandensis E264]
MQTAQRRIDPGVVERLLDEPHRFEFFQAVRLLETWFAKRHPQRHAASRPGEIVARRIGFRNTLSLGFPPS
EIERAQSYDAAGDALKDDSQRNAALEAGALSRVELTPAFFGLLGGQGALPLHYTEQIIAREQLKRDHAAR
AFFDVFSNRATALFYSAWKKYRLPLHYELDRDERYLPLLLALAGVSNDDARSTVQQGRGALLDEAIAGYA
LAARHRPVSAAYLQRTLSEYFGVPIRIEQFVGKWYDVPSDQLSVLGDVNVTLGATALVGERVWQRDMRAR
LVVGPLTKRDYEAFLPGEERAIALERMLTLLAGVTLEYEVSLVLRRAEVGASVLGVGARLGWDAFLCTRE
AERDRADARYELHVIH
 
Nucleotide Sequence: 1101 bp     [Download]
>gi|83718394|ref|NC_007651.1|:c3407342-3406242 Burkholderia thailandensis E264 chromosome I, complete sequence
ATGCAAACCGCGCAGCGGCGAATCGATCCTGGCGTAGTCGAGCGGCTGCTCGACGAGCCGCATCGCTTCG
AGTTCTTCCAGGCAGTGCGGCTGCTCGAGACCTGGTTCGCGAAGCGCCATCCGCAACGCCATGCTGCGAG
CCGGCCGGGCGAGATCGTCGCGCGGCGGATCGGTTTTCGCAATACGCTGTCGCTCGGCTTTCCGCCGAGC
GAGATCGAGCGCGCGCAATCGTATGACGCAGCGGGCGACGCGCTGAAGGACGATTCGCAGCGCAACGCGG
CGCTCGAGGCGGGCGCGCTGTCGCGCGTCGAGCTCACGCCGGCGTTCTTCGGGCTGCTGGGCGGCCAGGG
CGCGCTGCCGCTGCATTACACCGAGCAGATCATCGCGCGCGAGCAATTGAAGCGCGATCACGCGGCGCGC
GCATTCTTCGATGTCTTCTCGAACCGCGCGACCGCGCTGTTCTACTCGGCGTGGAAGAAGTACCGTTTGC
CGCTGCATTACGAGCTCGATCGCGACGAGCGCTATTTACCCCTCTTGCTCGCGCTCGCGGGCGTGTCGAA
CGACGATGCGCGCTCGACCGTGCAGCAGGGCCGCGGCGCGCTGCTCGATGAAGCGATCGCCGGCTATGCG
CTCGCCGCGCGGCATCGGCCGGTGTCGGCCGCGTATCTGCAGCGCACGCTGTCCGAGTATTTCGGCGTGC
CGATCCGCATCGAGCAGTTCGTCGGCAAGTGGTATGACGTGCCGTCCGATCAACTGAGCGTGCTGGGCGA
CGTGAACGTGACGCTCGGCGCGACGGCGCTCGTCGGCGAACGCGTATGGCAGCGCGACATGCGCGCGAGG
CTCGTCGTCGGCCCGCTGACGAAGCGCGACTACGAGGCGTTCCTGCCCGGCGAGGAGCGCGCGATCGCAC
TCGAGCGAATGCTGACGCTGCTCGCCGGCGTGACGCTCGAGTACGAAGTGTCGCTCGTGCTGCGCCGCGC
GGAGGTCGGCGCGAGCGTTCTCGGCGTGGGCGCGCGGCTCGGCTGGGATGCGTTTCTCTGCACGCGTGAA
GCCGAGCGTGATCGCGCCGACGCACGCTACGAACTGCACGTCATTCATTGA