SecReT6
Protein ID: 83721066
SecReT6 ID115
T6SS typei4b
Gene symbol-
Locus tagBTH_I2962
StrainBurkholderia thailandensis E264
Repliconchromosome I [GenBank: NC_007651] [Browse all T6SS(s) in this replicon]
Location [Strand]3409765..3410268 [-]
Producthypothetical protein
NoteTssD
UniProt IDQ2SUD0
KEGG IDbte:BTH_I2962
PDB IDNA
Domain hit(s) vs Pfam DUF796 [PF05638], Evalue: 1.50E-44, Aligned region: 6..139
Protein Sequence: 167 a.a.     [Download]
>gi|83721066|ref|YP_443469.1| hypothetical protein BTH_I2962 [Burkholderia thailandensis E264]
MLHMHLKFGSPAIKGESADKDHEGWIELKSWDHSIVQPRSATASTAGGHTATRCEHGDMVFTKEIDSSSP
LLYQHASGGTTFDEVTVDFLRADGEGQRVKYLEIKLKYVIISSIAPSVHNEGLPLETFSLKYAAVQWKQT
QQKIGGNQGGNTQGAWSLTKNDKTYAV
 
Nucleotide Sequence: 504 bp     [Download]
>gi|83718394|ref|NC_007651.1|:c3410268-3409765 Burkholderia thailandensis E264 chromosome I, complete sequence
ATGTTACATATGCATTTGAAGTTCGGTAGTCCCGCCATCAAGGGCGAGTCCGCCGACAAGGACCACGAAG
GCTGGATCGAACTGAAATCCTGGGATCACTCGATCGTTCAGCCGCGTTCGGCAACCGCGTCGACCGCGGG
CGGCCACACGGCAACGCGTTGCGAGCACGGCGACATGGTGTTCACGAAGGAAATCGATTCGTCGAGCCCG
CTGCTGTATCAGCACGCGTCGGGCGGCACCACGTTCGACGAGGTGACGGTCGATTTCCTGCGCGCGGATG
GCGAAGGCCAGCGCGTCAAGTACCTCGAGATCAAGCTGAAGTACGTGATCATCTCGAGCATCGCGCCGAG
CGTGCACAACGAAGGCCTGCCGCTCGAGACCTTCTCGCTGAAGTACGCCGCGGTTCAGTGGAAGCAGACC
CAGCAGAAGATCGGCGGCAACCAGGGCGGCAACACGCAGGGCGCCTGGAGCCTCACGAAGAACGACAAGA
CCTACGCGGTCTAA