SecReT6
Protein ID: 83721364
SecReT6 ID115
T6SS typei4b
Gene symbol-
Locus tagBTH_I2963
StrainBurkholderia thailandensis E264
Repliconchromosome I [GenBank: NC_007651] [Browse all T6SS(s) in this replicon]
Location [Strand]3410341..3411831 [-]
Producthypothetical protein
NoteTssC
UniProt IDQ2SUC9
KEGG IDbte:BTH_I2963
PDB IDNA
Domain hit(s) vs Pfam DUF877 [PF05943], Evalue: 2.60E-189, Aligned region: 67..491
Protein Sequence: 496 a.a.     [Download]
>gi|83721364|ref|YP_443470.1| hypothetical protein BTH_I2963 [Burkholderia thailandensis E264]
MNQQTAAAQSTGAQVGTESSLLDEIVEKSKVAKSESEHARAKDLIGELVNQVLDGTVVVSDNLSATIDAR
VAELDRLISSQLSAVMHAAEFQRLESTWRGLDYLVKESNTGSTIKIKALHAPKRDLVRDFKNATEFDQSA
LFKKVYEEEFGTFGGSPFGVLVGDYEISRQPEDQYFIEQMSHVAAAAHAPFIASAAPELLGLESFADLGK
PRDLGKVFDTVEYAKWKSFRDSEDSRYVGLTLPRFLGRLPFNPKDGAIAESFNFVEDVDGTDHDKYLWCN
ASWAFAARLTAAFDDFGWCAAIRGVEGGGLVEDLPTHTFKTDDGEIALKCPTEIAITDRREKELSDLGFI
PLVHCKNSDYAAFFAAQSVQKPKKYSTDSANANAVLSAQLQYIFSVSRIAHYLKAMMRDKIGSFASAQNV
ETFLNRWISQYVLLDDDATQEQKAQFPLREASVQVSEIPGKPGAYRSVAFLRPHFQLDELSISLRLVADL
PKPANS
 
Nucleotide Sequence: 1491 bp     [Download]
>gi|83718394|ref|NC_007651.1|:c3411831-3410341 Burkholderia thailandensis E264 chromosome I, complete sequence
ATGAACCAGCAAACGGCTGCGGCCCAATCGACCGGCGCTCAAGTCGGCACGGAGTCCTCGCTGCTCGACG
AGATCGTCGAGAAGAGCAAGGTCGCGAAATCCGAATCCGAGCATGCGCGCGCGAAGGATTTGATCGGCGA
ACTCGTCAATCAGGTGCTCGACGGCACGGTGGTCGTGTCGGACAACCTGTCGGCGACGATCGACGCGCGC
GTCGCGGAGCTCGACCGCCTGATTTCGTCGCAACTCTCGGCCGTGATGCACGCGGCGGAGTTTCAGCGTC
TCGAGAGCACGTGGCGCGGGCTCGACTATCTGGTGAAGGAAAGCAACACCGGCTCGACGATCAAGATCAA
GGCGCTGCACGCGCCGAAGCGCGATCTCGTGCGCGACTTCAAGAATGCGACCGAGTTCGATCAGAGCGCG
CTCTTCAAGAAGGTGTACGAAGAAGAATTCGGCACGTTCGGCGGCTCGCCGTTCGGCGTGCTGGTGGGCG
ACTACGAGATCTCGCGCCAGCCGGAGGATCAGTACTTCATCGAGCAGATGTCGCATGTCGCGGCGGCCGC
GCACGCGCCGTTCATCGCATCGGCGGCGCCCGAGCTGCTCGGCCTCGAATCGTTCGCCGATCTCGGCAAG
CCGCGCGATCTCGGCAAGGTGTTCGACACGGTCGAATACGCGAAGTGGAAGTCGTTTCGCGATTCCGAGG
ATTCGCGCTACGTCGGCCTCACGTTGCCGCGCTTCCTCGGCCGCCTGCCGTTCAATCCGAAGGACGGCGC
GATCGCGGAGAGCTTCAACTTCGTCGAGGACGTCGACGGCACCGATCACGACAAGTACCTGTGGTGCAAC
GCGTCGTGGGCGTTTGCCGCGCGCCTGACGGCCGCGTTCGACGATTTCGGCTGGTGCGCGGCGATTCGCG
GCGTGGAAGGCGGCGGCCTCGTCGAGGATCTGCCGACGCACACGTTCAAGACCGACGACGGCGAAATCGC
GCTGAAGTGCCCGACCGAGATCGCGATCACCGATCGCCGCGAGAAGGAGCTGAGCGACCTCGGCTTCATC
CCGCTCGTGCATTGCAAGAATTCCGATTACGCCGCGTTCTTCGCCGCGCAGTCGGTGCAGAAACCCAAGA
AATACAGCACCGACAGCGCCAATGCGAACGCCGTCCTGTCCGCTCAGCTGCAGTACATTTTTTCGGTATC
GCGCATCGCGCATTACCTGAAAGCGATGATGCGCGACAAGATCGGCAGCTTTGCGTCCGCACAGAATGTC
GAAACGTTCCTCAATCGCTGGATCTCGCAGTACGTGTTGCTCGACGACGACGCGACCCAGGAACAGAAAG
CGCAGTTCCCGCTGCGCGAGGCCTCCGTACAAGTGTCAGAGATTCCGGGCAAGCCGGGTGCGTATCGTTC
GGTCGCGTTTTTGCGTCCGCACTTCCAGCTCGACGAGTTGTCGATTTCTCTGCGCCTTGTCGCTGATCTG
CCCAAACCGGCAAATTCATAA