SecReT6
Protein ID: 84624543
SecReT6 ID116
T6SS typei3
Gene symbol-
Locus tagXOO_2886
StrainXanthomonas oryzae pv. oryzae MAFF 311018
Repliconchromosome [GenBank: NC_007705] [Browse all T6SS(s) in this replicon]
Location [Strand]3258047..3259075 [+]
Producthypothetical protein
NoteTssA
UniProt IDQ2P1D6
KEGG IDxom:XOO_2886
PDB IDNA
Domain hit(s) vs Pfam ImpA-rel_N [PF06812], Evalue: 4.50E-20, Aligned region: 54..114
Protein Sequence: 342 a.a.     [Download]
>gi|84624543|ref|YP_451915.1| hypothetical protein XOO_2886 [Xanthomonas oryzae pv. oryzae MAFF 311018]
MQIDNAPLLRPVDEQVPSGPNLEYTPEFQSLEELARPRQERALGAGVLVPDAPQWRQVAESAEHLLGRSK
DLRLGILLSIARLHQDGLVGWSSGVGLLRQLLEQFWGDVHPHLDADEDNDPTERVNAIAALADSERTLTQ
LRNVRLFKGLHPGHFSLRDLRIVQGTLKLAAEDASEIPDPAAIDACLRDCPLEALLDLDAALAAAQDDIA
AIAGVFAERTPGHGPELAPLTQDLDELRAFLRPYVSERSGSPAEPTEHAAPGADTVRTSTPRAHAVEHPD
EVRRMLDQLCDYYARREPSSPVPLLLRRAQRLVGLDFTALIRDLAPRAIEELQVVSGQEHSD
 
Nucleotide Sequence: 1029 bp     [Download]
>gi|84621657|ref|NC_007705.1|:3258047-3259075 Xanthomonas oryzae pv. oryzae MAFF 311018 chromosome, complete genome
ATGCAGATCGACAACGCACCGTTGCTGCGACCGGTCGACGAACAGGTGCCATCCGGTCCGAACCTGGAAT
ACACCCCGGAGTTCCAGAGCCTGGAGGAACTTGCACGACCGCGTCAGGAGCGCGCCTTGGGCGCTGGCGT
GCTTGTGCCCGACGCGCCGCAATGGCGCCAGGTCGCCGAGAGCGCCGAACACTTGCTAGGGCGCTCCAAG
GACTTGCGGCTGGGCATCTTGCTGAGCATCGCCCGCTTGCACCAGGACGGTCTGGTGGGCTGGTCCAGCG
GCGTCGGCCTGCTCCGACAACTGCTGGAGCAGTTCTGGGGCGACGTCCATCCTCATCTGGATGCCGATGA
AGACAACGACCCGACCGAACGCGTCAACGCCATCGCTGCGTTGGCCGACAGCGAGCGCACGCTGACACAG
CTGCGCAACGTGCGCCTATTCAAGGGACTGCATCCAGGACATTTCTCGCTGCGCGATCTGCGCATCGTGC
AAGGCACGCTCAAGCTCGCTGCGGAGGACGCGAGCGAGATACCAGATCCTGCCGCCATCGATGCCTGCCT
GCGCGACTGCCCGCTGGAGGCGTTGCTTGATCTGGACGCAGCCCTGGCCGCTGCGCAGGACGACATTGCC
GCAATTGCCGGCGTGTTCGCCGAGCGCACTCCGGGGCACGGTCCGGAGCTGGCACCGCTCACGCAGGATC
TGGACGAGTTGCGTGCGTTCCTGCGGCCCTATGTGTCCGAACGTTCCGGATCCCCGGCCGAGCCGACCGA
ACATGCAGCACCGGGCGCCGACACTGTCAGGACATCGACGCCACGCGCGCACGCCGTGGAGCATCCGGAC
GAGGTTCGCCGCATGCTCGACCAGCTCTGCGATTACTACGCGCGGCGCGAGCCCTCCAGCCCGGTGCCGT
TACTGTTGCGGCGCGCACAACGCCTGGTCGGCCTGGATTTCACCGCACTGATACGCGATCTCGCGCCGCG
CGCGATTGAAGAGCTGCAAGTGGTGTCGGGCCAGGAGCATTCCGACTAG