SecReT6
Protein ID: 84624550
SecReT6 ID116
T6SS typei3
Gene symbol-
Locus tagXOO_2893
StrainXanthomonas oryzae pv. oryzae MAFF 311018
Repliconchromosome [GenBank: NC_007705] [Browse all T6SS(s) in this replicon]
Location [Strand]3268614..3269951 [-]
Producthypothetical protein
NoteTssK
UniProt IDQ2P1C9
KEGG IDxom:XOO_2893
PDB IDNA
Domain hit(s) vs Pfam DUF876 [PF05936], Evalue: 4.30E-151, Aligned region: 19..444
Protein Sequence: 445 a.a.     [Download]
>gi|84624550|ref|YP_451922.1| hypothetical protein XOO_2893 [Xanthomonas oryzae pv. oryzae MAFF 311018]
MTPYNKVIWSEGLFLRPQHLQQQERYLERYMELHAGALRPHAWGFSVLELEPELLSIGKLGIRRARGCFP
DGTPFSIPDRDPAPPPLDVPANCRDQVVSLALPLRATTQPDSTWPDGDGSRLARYRVGEAEVGDSSGSIA
GTVLLEVGVLASRLRLQSEPGEGLVEVPMARIVECRADRRVILDDAFIPTAIRIEGAARLSMLLAELLGL
LHQRGQALADRVAGSDRRGVAEIADVLMLQVINRYQPLVAHWASAPLEHPEALYCVLLGMAGELATFTRA
SKRSGPFPPYAHDALQASFEPVVVSLRESLSAVLEQSAIAVPLQQRKYGVWVGMVPDPALLDAAAFVLAV
KADLRAEDLRKRLPAESKIGPVEKIRDLVNLQLPGVAVSALAMAPRQVPYHAGCAYFELDRQSSLWKTLR
TSGGVALHFGSGFPGLELELWAVRN
 
Nucleotide Sequence: 1338 bp     [Download]
>gi|84621657|ref|NC_007705.1|:c3269951-3268614 Xanthomonas oryzae pv. oryzae MAFF 311018 chromosome, complete genome
ATGACCCCTTACAACAAGGTGATCTGGAGCGAGGGCCTGTTCCTGCGCCCGCAGCACCTGCAACAACAGG
AGCGCTATCTGGAGCGCTACATGGAACTGCATGCCGGTGCGCTCCGGCCGCATGCGTGGGGTTTCAGCGT
ACTGGAGCTGGAGCCGGAATTGCTGTCCATCGGCAAGCTCGGCATCCGGCGCGCCCGCGGCTGCTTTCCC
GATGGCACGCCGTTTTCCATTCCCGATCGCGATCCGGCACCGCCGCCGTTGGACGTGCCGGCCAACTGCC
GCGACCAGGTGGTGAGTCTGGCGCTGCCGCTGCGCGCGACCACGCAGCCGGATAGCACCTGGCCGGATGG
CGACGGCAGCCGGCTGGCCCGTTATCGCGTGGGCGAAGCGGAGGTCGGCGATTCGTCCGGCAGCATCGCC
GGCACGGTCCTGCTGGAAGTCGGCGTGCTGGCCAGTCGCCTACGCCTGCAGTCCGAACCGGGGGAGGGGC
TGGTGGAGGTGCCGATGGCGCGCATTGTCGAGTGCCGCGCCGATCGACGGGTGATTCTCGATGATGCCTT
CATCCCGACCGCCATCCGCATCGAAGGCGCCGCGCGGTTGTCCATGCTGCTGGCCGAATTGCTTGGGCTA
TTGCATCAACGCGGCCAGGCGCTGGCCGACCGCGTGGCCGGCAGCGACCGTCGCGGCGTGGCGGAAATCG
CAGACGTGCTGATGTTGCAGGTGATCAATCGCTACCAGCCGCTGGTGGCGCATTGGGCAAGCGCGCCGCT
GGAGCATCCCGAAGCGCTGTATTGCGTGCTGCTGGGGATGGCTGGCGAACTCGCGACCTTCACCCGTGCC
AGTAAACGTAGCGGGCCATTTCCGCCGTACGCACACGATGCGCTGCAGGCGAGCTTCGAGCCGGTGGTGG
TGTCCTTGCGCGAAAGCTTGAGCGCGGTGCTCGAACAGTCGGCGATCGCCGTGCCCTTGCAGCAACGCAA
ATACGGCGTGTGGGTGGGCATGGTGCCCGATCCGGCCTTGCTGGACGCGGCGGCCTTCGTGCTGGCAGTC
AAGGCGGATCTGCGCGCCGAGGATCTGCGCAAGCGGCTACCCGCCGAATCGAAGATCGGCCCGGTGGAGA
AGATTCGCGACCTGGTGAACCTGCAACTGCCCGGGGTGGCCGTGAGTGCGCTGGCGATGGCACCGCGGCA
GGTGCCGTATCACGCCGGCTGCGCCTACTTCGAACTCGATCGGCAATCGTCGCTGTGGAAGACGCTGCGC
ACGTCCGGTGGCGTGGCGCTGCATTTCGGCAGTGGTTTTCCCGGCCTGGAACTTGAGTTGTGGGCGGTGA
GGAATTGA