SecReT6
Protein ID: 84624551
SecReT6 ID116
T6SS typei3
Gene symbol-
Locus tagXOO_2894
StrainXanthomonas oryzae pv. oryzae MAFF 311018
Repliconchromosome [GenBank: NC_007705] [Browse all T6SS(s) in this replicon]
Location [Strand]3269948..3271339 [-]
Producthypothetical protein
NoteFha
UniProt IDQ2P1C8
KEGG IDxom:XOO_2894
PDB IDNA
Domain hit(s) vs Pfam FHA [PF00498], Evalue: 1.70E-14, Aligned region: 34..97
Protein Sequence: 463 a.a.     [Download]
>gi|84624551|ref|YP_451923.1| hypothetical protein XOO_2894 [Xanthomonas oryzae pv. oryzae MAFF 311018]
MSAVSPRLTLTVRDAQAVSGGTQAQASFAAEGGRIGRDATCDWVLEGEGVSRLHASVRHLDGVYFIEDHS
TNGVLHNGVPLRAGFPVPLHAGDALRIDAFEIDVAVSGASVTAGAAATQNWNHAEPCTLSAMPLPQQSQH
APLEHDVFAALGASSMRATDTDPLALFATSFTLAGRQSDAAAFGLGHAPATAEAYRAPVAAPAAGGVVLP
EHWDLTRSEFALPPAADPVADMQAPLPSAAVPIAAAAAAAPAPTPTPTPLPTSVSQTRGAAVAVSAAAPS
AAQPVVAHTPDTPELPALFAAMTAGLMDVLRARAAFKNSLRVPVTLIQRTENNPLKFAATVDEAVARLLA
PPSPGYLTGAAAIEAAVEDIGRHQLALLAGMRAAFEHVFAQFDPARFEADTAGSALGSWGNRHWRRYAQH
YRELLGDPDERFRRLFGEEFARAYEQQLARAKAQAQPTDGDRA
 
Nucleotide Sequence: 1392 bp     [Download]
>gi|84621657|ref|NC_007705.1|:c3271339-3269948 Xanthomonas oryzae pv. oryzae MAFF 311018 chromosome, complete genome
ATGAGCGCGGTGTCACCCCGGCTGACGCTGACGGTTCGCGATGCGCAGGCGGTGTCGGGCGGCACACAAG
CGCAGGCCAGCTTCGCGGCAGAAGGCGGGCGCATCGGCCGCGACGCCACCTGCGATTGGGTGCTCGAAGG
CGAGGGGGTGTCGCGCCTGCACGCCAGCGTGCGCCATCTCGATGGGGTGTATTTCATCGAAGACCACAGC
ACTAACGGCGTGTTGCATAACGGCGTGCCGCTACGTGCCGGTTTTCCGGTGCCGCTGCATGCCGGCGACG
CCTTGCGCATCGATGCCTTCGAGATCGACGTGGCGGTGTCGGGCGCAAGCGTTACCGCTGGTGCAGCCGC
GACGCAGAACTGGAATCACGCCGAACCGTGCACGCTGTCGGCAATGCCACTGCCGCAGCAGTCGCAGCAC
GCGCCGCTGGAGCATGATGTTTTCGCCGCGCTTGGGGCGTCGTCGATGCGGGCAACCGACACCGACCCAC
TGGCATTGTTCGCCACCTCGTTCACGCTGGCCGGTCGCCAGAGCGATGCGGCGGCGTTCGGGCTGGGGCA
TGCGCCGGCAACGGCCGAGGCCTACCGCGCACCCGTGGCCGCGCCGGCTGCCGGCGGCGTTGTGTTGCCC
GAGCACTGGGACCTGACACGCAGCGAATTTGCGCTGCCGCCGGCTGCCGATCCAGTGGCAGACATGCAAG
CGCCACTGCCGTCCGCCGCAGTGCCTATTGCCGCAGCGGCGGCGGCAGCACCCGCACCGACGCCCACACC
CACACCACTGCCAACGTCGGTCTCGCAAACGCGTGGCGCGGCAGTAGCGGTGAGCGCTGCCGCCCCCTCC
GCGGCGCAGCCGGTAGTTGCACACACGCCGGATACCCCCGAGCTGCCTGCGCTGTTCGCCGCCATGACCG
CTGGCTTGATGGATGTCTTGCGCGCGCGTGCGGCGTTCAAGAACAGCCTGCGCGTGCCGGTCACGCTGAT
CCAACGCACCGAGAACAATCCGCTCAAGTTCGCCGCGACGGTGGACGAGGCGGTCGCCCGCCTGTTGGCG
CCGCCGAGCCCTGGGTATCTGACCGGTGCGGCCGCGATCGAAGCAGCGGTGGAGGACATCGGGCGTCACC
AGCTGGCCTTGTTGGCCGGCATGCGTGCCGCCTTTGAGCATGTGTTTGCCCAGTTCGATCCAGCGCGCTT
CGAGGCAGACACCGCCGGCTCCGCGCTCGGTTCCTGGGGCAATCGGCACTGGCGACGCTACGCGCAGCAT
TACCGCGAGTTGCTCGGCGATCCCGACGAGCGCTTCCGCCGCCTGTTCGGCGAAGAATTCGCCCGCGCCT
ACGAACAACAGCTGGCCCGTGCCAAGGCGCAGGCTCAACCCACAGACGGCGACCGAGCATGA