SecReT6
Protein ID: 84624553
SecReT6 ID116
T6SS typei3
Gene symbol-
Locus tagXOO_2896
StrainXanthomonas oryzae pv. oryzae MAFF 311018
Repliconchromosome [GenBank: NC_007705] [Browse all T6SS(s) in this replicon]
Location [Strand]3271884..3273932 [-]
Producthypothetical protein
NoteTssI
UniProt IDQ2P1C6
KEGG IDxom:XOO_2896
PDB IDNA
Domain hit(s) vs Pfam Phage_GPD [PF05954], Evalue: 5.10E-73, Aligned region: 60..365
Phage_base_V [PF04717], Evalue: 2.90E-21, Aligned region: 407..500
Protein Sequence: 682 a.a.     [Download]
>gi|84624553|ref|YP_451925.1| hypothetical protein XOO_2896 [Xanthomonas oryzae pv. oryzae MAFF 311018]
MWHRDYRFPCTPARPAKSSHAIDLCAYVPQDHSGSLTMAHAITLQSPLGKTLRFVRMSAHEALGRPYAFA
LHGISRDVAIDLRALLGKPMAVKVTSPQGYVRHYHGIVAEAEQTGFEQIEGLRYATYAFSLVPKLWLLGQ
RRDCRIYKNKSVPELVRALLAEVGCTDVKLRLSASYTPREYCVQYRESALDFISRLMEQEGIYYYFAHSA
STHTLVLADSLGAHESSAPFAQIPYCPPGQKGSRMKDAITDWSLARSAHSTRVRLDDYDYLKPKASLRVD
ETPAESSGPALGELDVFDYPGEHLDVAAGRRHAQVRAEALNVAQAQYQGWTDACGLQVGALFKLRDFPLA
EHNQEYLVTSADTELVEVDYVSGGQTVAEPFASTFRALRSRQPFRTPQTTPRPSIAGVQTALVDGNKAED
IAVDQYGRVQVNFFWSPPGTPNAVCSCPVRVAQSWAGKRWGAQHIPRVGQEVVVSFLEGNPDRPLIIGSV
YNADQLPPYALPEHRTRSGVKSRSLSGGAEDYNEIRFDDKKGNEELLLHAQRDLRHEAENDHFVTVDRNE
TAEIKRERSHTVGGNDRLDVGKTLRIQAGSEIALVTGMARLQLKASGEIVLSGTRLTLDGRVSVGIQGGV
SVDVSAMANLTLRSNASVLLQSNAVTTARANAALLLQSSGPAVLKGTPPIIA
 
Nucleotide Sequence: 2049 bp     [Download]
>gi|84621657|ref|NC_007705.1|:c3273932-3271884 Xanthomonas oryzae pv. oryzae MAFF 311018 chromosome, complete genome
GTGTGGCATCGCGATTATCGATTTCCCTGCACCCCGGCGCGGCCGGCAAAGTCATCGCATGCCATCGACC
TTTGCGCCTATGTACCGCAAGACCACTCCGGGAGCCTGACCATGGCCCACGCCATTACCCTGCAGTCGCC
GCTTGGCAAGACGCTGCGCTTTGTGCGGATGAGCGCGCACGAGGCACTGGGGCGGCCCTATGCGTTCGCG
TTGCACGGCATCAGCCGCGATGTGGCGATCGACCTGCGCGCTCTGCTGGGCAAGCCGATGGCGGTCAAGG
TCACTTCACCGCAGGGCTATGTGCGGCATTACCACGGCATCGTCGCCGAGGCGGAGCAGACCGGGTTCGA
GCAGATCGAGGGGCTGCGCTACGCCACCTATGCCTTCTCGCTGGTGCCCAAGCTGTGGTTGCTCGGGCAG
CGCCGCGATTGCCGCATCTACAAGAACAAGAGCGTGCCGGAGCTGGTGCGCGCGTTGCTGGCCGAGGTTG
GATGCACCGACGTGAAGCTGCGCCTGAGCGCGAGCTACACGCCGCGCGAATACTGCGTGCAGTACCGCGA
GAGCGCGCTGGACTTCATCAGCCGCTTGATGGAGCAAGAGGGCATCTACTACTACTTCGCACACAGTGCC
AGCACGCATACGCTGGTGCTGGCCGACAGTCTCGGCGCGCACGAATCCTCTGCGCCATTCGCACAAATCC
CTTACTGCCCGCCCGGGCAGAAGGGCAGCCGGATGAAGGACGCGATCACCGATTGGTCGCTGGCGCGCAG
CGCGCACAGCACGCGCGTGCGCCTGGACGACTACGACTATCTCAAGCCCAAGGCCTCGCTGCGGGTGGAC
GAGACACCGGCCGAGTCTTCGGGACCGGCGCTGGGCGAGCTGGATGTGTTCGATTATCCCGGCGAGCATC
TCGATGTCGCGGCCGGTCGTCGTCACGCGCAGGTGCGTGCCGAAGCGCTCAACGTGGCGCAGGCGCAATA
CCAGGGCTGGACCGATGCCTGCGGTTTGCAGGTGGGCGCATTGTTCAAGCTGCGCGACTTTCCGCTGGCC
GAGCACAACCAGGAATACCTGGTGACCAGCGCGGACACCGAACTGGTTGAAGTGGATTATGTGTCCGGTG
GCCAGACGGTTGCCGAGCCGTTTGCGTCCACCTTCCGTGCGCTACGCAGTCGGCAGCCGTTTCGGACCCC
GCAGACCACGCCGCGTCCGAGTATTGCCGGGGTGCAGACCGCGCTCGTCGACGGCAACAAGGCCGAGGAT
ATTGCGGTCGATCAGTACGGCCGTGTGCAGGTGAATTTCTTCTGGAGTCCGCCGGGAACGCCAAACGCCG
TCTGCTCGTGCCCGGTACGCGTGGCGCAGTCGTGGGCGGGCAAACGCTGGGGCGCGCAGCACATTCCGCG
TGTGGGCCAGGAGGTGGTGGTGAGCTTTCTGGAAGGCAATCCGGATCGTCCGCTGATCATCGGCAGCGTC
TACAACGCCGACCAGCTGCCACCGTATGCACTGCCCGAGCACCGCACCCGTAGCGGGGTAAAGAGCCGCA
GCCTGTCGGGTGGGGCAGAGGACTACAACGAGATCCGTTTCGACGACAAGAAGGGCAACGAAGAGCTGCT
GCTGCATGCGCAGCGCGATCTGCGCCACGAAGCGGAGAACGACCATTTCGTCACTGTCGACCGCAACGAA
ACCGCCGAGATCAAACGCGAACGCAGCCACACCGTTGGCGGCAACGACCGTCTGGACGTGGGCAAGACAC
TCCGCATCCAGGCAGGGAGCGAGATCGCGTTGGTGACCGGGATGGCTCGCCTGCAGTTGAAGGCCAGCGG
CGAGATCGTGCTCAGCGGCACCCGGCTCACGCTCGATGGACGCGTCAGCGTCGGCATCCAGGGTGGCGTC
AGTGTCGATGTCAGCGCGATGGCCAACCTGACCCTGCGCTCGAACGCGTCGGTGCTGCTGCAATCCAACG
CCGTGACCACCGCGCGCGCCAACGCGGCGCTGCTGTTGCAGTCGTCAGGTCCGGCCGTGCTCAAGGGCAC
TCCGCCCATCATCGCTTGA