SecReT6
Protein ID: 84624557
SecReT6 ID116
T6SS typei3
Gene symbol-
Locus tagXOO_2900
StrainXanthomonas oryzae pv. oryzae MAFF 311018
Repliconchromosome [GenBank: NC_007705] [Browse all T6SS(s) in this replicon]
Location [Strand]3278915..3279925 [-]
Producthypothetical protein
NoteTssG
UniProt IDQ2P1C2
KEGG IDxom:XOO_2900
PDB IDNA
Domain hit(s) vs Pfam DUF1305 [PF06996], Evalue: 8.20E-110, Aligned region: 20..321
Protein Sequence: 336 a.a.     [Download]
>gi|84624557|ref|YP_451929.1| hypothetical protein XOO_2900 [Xanthomonas oryzae pv. oryzae MAFF 311018]
MASPSRQSADPVALFARLDAQPQAFELFEALRWLECAHPAQPRLGQAARPLEEPVRLGQRASLEFPPRDI
DSVHAGVDGRPPTLRTLSLGLFGPHGALPLHLTEHAIERESAGDPTFAAFADMFHHRMIALWYRAWADAR
PTVQMDRVGDDRFGARLDALTGVDQPALRDRDAMPVAARRHFAGRFIAQARNAEGLRAVLTGLFDVPVQV
QEFVANWLTLPEEGRLRMGRAAARIGRDATLGASARNAQHRFRLRIGPLEIARYREFLPGGQALDVLTAA
VRGYIGDEQAWDLQLVLAREDVPLPVLGQGQRIGLSLWLGHYRRTLDADQLVLTSP
 
Nucleotide Sequence: 1011 bp     [Download]
>gi|84621657|ref|NC_007705.1|:c3279925-3278915 Xanthomonas oryzae pv. oryzae MAFF 311018 chromosome, complete genome
ATGGCCAGCCCATCTCGGCAATCGGCCGATCCTGTAGCGCTGTTCGCGCGGCTGGATGCGCAACCGCAGG
CCTTCGAGCTATTCGAAGCGCTGCGGTGGCTGGAGTGCGCGCATCCGGCGCAACCGCGTCTGGGCCAGGC
AGCACGGCCGTTGGAAGAGCCTGTGCGTTTGGGCCAGCGCGCCTCGCTGGAATTTCCTCCGCGCGACATC
GACAGCGTGCACGCTGGCGTTGACGGTCGCCCGCCGACCCTGCGCACGCTGTCGCTGGGCTTGTTCGGCC
CGCATGGTGCGCTGCCGTTGCACCTGACCGAGCACGCCATCGAACGTGAAAGCGCTGGCGATCCCACCTT
TGCGGCCTTTGCCGACATGTTTCACCATCGCATGATTGCGCTGTGGTATCGCGCCTGGGCCGATGCGCGA
CCCACCGTGCAGATGGATCGCGTGGGCGATGACCGCTTCGGCGCGCGGCTGGATGCGTTAACCGGTGTGG
ACCAACCTGCGTTACGTGATCGCGATGCGATGCCGGTGGCTGCACGCCGGCACTTCGCCGGTCGCTTCAT
TGCCCAGGCGCGCAATGCGGAAGGCTTGCGTGCTGTGCTGACCGGCCTGTTCGACGTCCCGGTGCAGGTG
CAGGAATTCGTTGCCAACTGGTTGACGCTGCCCGAGGAAGGGCGACTGCGGATGGGACGTGCTGCTGCGC
GTATCGGGCGTGACGCCACGCTTGGCGCATCGGCGCGCAACGCGCAGCATCGCTTCCGCCTGCGGATCGG
CCCCTTGGAGATCGCCCGCTACCGCGAGTTCCTGCCGGGCGGCCAGGCCCTGGACGTACTGACCGCCGCA
GTACGCGGCTACATCGGCGACGAGCAGGCCTGGGACTTACAACTCGTGCTGGCGCGCGAAGACGTCCCGT
TGCCAGTCCTGGGGCAGGGCCAGCGCATCGGCCTGTCGCTGTGGCTCGGCCACTATCGCCGCACGCTCGA
TGCCGACCAGCTCGTGCTTACGTCGCCCTGA