SecReT6
Protein ID: 84624558
SecReT6 ID116
T6SS typei3
Gene symbol-
Locus tagXOO_2901
StrainXanthomonas oryzae pv. oryzae MAFF 311018
Repliconchromosome [GenBank: NC_007705] [Browse all T6SS(s) in this replicon]
Location [Strand]3279889..3281766 [-]
Producthypothetical protein
NoteTssF
UniProt IDQ2P1C1
KEGG IDxom:XOO_2901
PDB IDNA
Domain hit(s) vs Pfam DUF879 [PF05947], Evalue: 3.20E-214, Aligned region: 5..625
Protein Sequence: 625 a.a.     [Download]
>gi|84624558|ref|YP_451930.1| hypothetical protein XOO_2901 [Xanthomonas oryzae pv. oryzae MAFF 311018]
MDPRLLHHYNRELQHVREMGAEFAQAYPKVAGRLGMSGIECADPYVERLLEGFAFLSARVQVELEAQQPA
FAQHLTEMLYPHFLSPVPSMAVVELQPEQGEGIGPAGHVVPRGSALRSLIGHGDRTACEYRTAHAVTLLP
LRLTAASYLTSPAALATLGVPVEPRARAGLRLVFNVDPGLRLDMLALDTLPIFITGADGLAGTLHEQLHA
NALGFVVRARSADGQVLTRTFGPEHLQPQGFDDEQALLPRSERSFSGYRLLQEYFACPERFLFTAFDGLA
QVLTRAACAEFEMLVWFDRSVERLDNAVDASNFRLHCTPAINLFPRRGDRIHLHPGISEHHVLADRTRPM
DFEIHGVEQVEGFGDGNAPMQRFEPFYGAQPRSWHERRSAFYALRRQPRRLSTGQRRTGPRSSYVGSEVF
LSLVDGDQAPYSHQLRQLGMQLWCSNRDLPLHMPVGKSSTDFVLDDGGPVASIRCVAGPTRPRSGVTAGD
TRWRLISHLQLNYLSLLDAGDDGATALREMLTLYHDPHDAAARRQVDGVRRIASRPIVRRIPVPGPATYG
RGLEITLTCDDAAFEGQGVYLLASVLRHVFARQASLNSFTETVLCTPERNEVARWPAHLGNRPIL
 
Nucleotide Sequence: 1878 bp     [Download]
>gi|84621657|ref|NC_007705.1|:c3281766-3279889 Xanthomonas oryzae pv. oryzae MAFF 311018 chromosome, complete genome
ATGGATCCGCGCCTGCTCCATCACTACAACCGCGAGTTGCAGCATGTGCGCGAGATGGGTGCGGAATTCG
CGCAGGCGTATCCGAAAGTGGCGGGCCGGCTTGGGATGAGCGGTATCGAGTGCGCCGACCCGTATGTCGA
ACGTCTGCTGGAAGGGTTTGCCTTCCTGTCTGCGCGCGTGCAGGTCGAACTCGAAGCCCAGCAGCCTGCA
TTCGCGCAGCATCTGACGGAAATGCTGTATCCACATTTCCTGTCGCCGGTGCCGTCGATGGCCGTGGTGG
AGCTGCAACCGGAGCAAGGCGAGGGCATCGGCCCAGCGGGGCATGTGGTGCCGCGCGGCAGCGCGTTGCG
CTCGTTGATCGGGCATGGCGACCGCACCGCCTGCGAATATCGCACCGCGCACGCGGTGACGCTGTTGCCG
CTGCGCCTGACTGCCGCCAGTTATCTCACCTCGCCGGCAGCGCTGGCCACGCTCGGTGTGCCGGTCGAGC
CGCGTGCGCGCGCCGGCCTTCGCCTGGTCTTCAACGTCGACCCCGGGCTGCGCCTGGACATGCTGGCGCT
GGACACATTGCCGATCTTCATCACCGGCGCCGATGGGTTGGCCGGCACCCTCCACGAACAACTGCATGCC
AATGCGTTGGGATTTGTGGTGCGTGCCCGCTCCGCGGATGGGCAGGTGCTGACGCGCACCTTCGGTCCCG
AGCATCTGCAGCCGCAGGGCTTCGATGACGAGCAGGCGCTGCTGCCGCGCAGCGAACGCTCTTTCAGCGG
CTATCGCCTGCTGCAGGAATATTTTGCCTGCCCCGAGCGTTTCCTGTTTACCGCCTTCGATGGCCTGGCG
CAGGTGCTGACGCGAGCGGCGTGCGCCGAATTCGAGATGTTGGTGTGGTTCGACCGCAGCGTCGAGCGGC
TCGATAACGCGGTGGACGCAAGTAACTTCCGCCTGCATTGCACCCCGGCGATCAACCTGTTTCCTCGGCG
CGGTGATCGTATCCATCTGCATCCCGGCATCTCCGAGCACCACGTGTTGGCTGACCGCACGCGGCCGATG
GACTTCGAGATTCATGGCGTGGAGCAGGTCGAAGGCTTCGGCGATGGCAATGCGCCAATGCAGCGTTTCG
AGCCGTTCTATGGCGCGCAGCCGCGCAGTTGGCATGAGCGGCGTTCGGCATTTTATGCCTTGCGACGGCA
GCCGCGGCGGCTGTCGACGGGACAGCGTCGTACCGGGCCGCGCTCGAGCTACGTTGGCAGCGAGGTGTTC
CTGTCGTTGGTCGATGGCGACCAGGCGCCGTATTCGCACCAACTGCGGCAACTGGGCATGCAGCTGTGGT
GCAGCAACCGCGATCTGCCGCTGCATATGCCGGTGGGCAAATCCAGCACCGACTTCGTCCTCGACGATGG
CGGCCCGGTGGCGTCGATCCGCTGCGTTGCAGGTCCAACGCGACCGCGCTCGGGCGTGACCGCCGGCGAT
ACCCGCTGGCGCCTGATCAGCCATCTGCAGTTGAACTATCTCTCGCTGCTGGATGCCGGCGACGACGGTG
CCACCGCATTGCGCGAGATGCTCACGCTGTACCACGACCCGCACGATGCCGCTGCGCGACGACAGGTAGA
CGGCGTGCGCCGCATCGCTTCGCGCCCGATCGTAAGGCGCATTCCGGTGCCGGGCCCGGCCACCTATGGC
CGCGGACTTGAGATCACCTTGACCTGCGACGACGCGGCCTTTGAAGGGCAGGGCGTCTATCTGCTTGCCT
CGGTGCTGCGGCATGTCTTTGCGCGCCAGGCATCGCTCAATTCCTTTACCGAAACCGTGCTATGCACGCC
CGAACGCAACGAGGTCGCTCGATGGCCAGCCCATCTCGGCAATCGGCCGATCCTGTAG