SecReT6
Protein ID: 84624559
SecReT6 ID116
T6SS typei3
Gene symbol-
Locus tagXOO_2902
StrainXanthomonas oryzae pv. oryzae MAFF 311018
Repliconchromosome [GenBank: NC_007705] [Browse all T6SS(s) in this replicon]
Location [Strand]3281770..3282273 [-]
Producthypothetical protein
NoteTssE
UniProt IDQ2P1C0
KEGG IDxom:XOO_2902
PDB IDNA
Domain hit(s) vs Pfam GPW_gp25 [PF04965], Evalue: 1.90E-20, Aligned region: 36..144
Protein Sequence: 167 a.a.     [Download]
>gi|84624559|ref|YP_451931.1| hypothetical protein XOO_2902 [Xanthomonas oryzae pv. oryzae MAFF 311018]
MAELTQQERLQPSLLDRLIDDRRHEPAESRDARAISPAKLRDCVMRDLAWLLNCTRHWHEDALQAYPHVA
SSVLNYGIPDLAGARLAGLDVIALQNRIREAIVAFEPRLAAASLQVTAKVDIGRMDRMSLSFVIDSELWA
QPLPLALYLRTDLDLETGRFSLSSAGH
 
Nucleotide Sequence: 504 bp     [Download]
>gi|84621657|ref|NC_007705.1|:c3282273-3281770 Xanthomonas oryzae pv. oryzae MAFF 311018 chromosome, complete genome
ATGGCCGAACTGACCCAACAAGAGCGTTTGCAGCCATCGCTGCTGGACCGATTGATCGACGACCGCCGAC
ACGAACCGGCGGAAAGCCGCGACGCGCGGGCGATCAGTCCAGCCAAGCTGCGCGACTGCGTCATGCGCGA
CCTGGCCTGGCTGCTCAATTGCACGCGCCACTGGCATGAGGATGCGTTGCAGGCGTATCCGCACGTCGCC
AGCTCGGTACTCAATTACGGCATTCCCGACCTGGCCGGCGCACGGCTGGCGGGGCTGGACGTGATCGCAC
TGCAGAACCGCATTCGTGAGGCGATTGTGGCGTTCGAGCCGCGCCTGGCTGCGGCCAGCCTGCAGGTCAC
CGCGAAAGTGGATATCGGGCGCATGGACCGCATGTCGCTGTCCTTCGTCATCGATTCCGAATTGTGGGCA
CAGCCGCTGCCGCTGGCGCTGTATCTGCGCACCGATCTCGATCTGGAAACCGGTCGTTTCAGTCTGTCTT
CGGCAGGCCACTGA