SecReT6
Protein ID: 84624560
SecReT6 ID116
T6SS typei3
Gene symbol-
Locus tagXOO_2903
StrainXanthomonas oryzae pv. oryzae MAFF 311018
Repliconchromosome [GenBank: NC_007705] [Browse all T6SS(s) in this replicon]
Location [Strand]3282261..3283094 [-]
Producthypothetical protein
NoteTagJ
UniProt IDQ2P1B9
KEGG IDxom:XOO_2903
PDB IDNA
Domain hit(s) vs Pfam ImpE [PF07024], Evalue: 2.10E-39, Aligned region: 144..266
TPR_19 [PF14559], Evalue: 0.00084, Aligned region: 13..68
TPR_19 [PF14559], Evalue: 0.00084, Aligned region: 113..132
TPR_14 [PF13428], Evalue: 0.0036, Aligned region: 13..46
TPR_14 [PF13428], Evalue: 0.0036, Aligned region: 43..68
TPR_14 [PF13428], Evalue: 0.0036, Aligned region: 113..134
TPR_16 [PF13432], Evalue: 0.0095, Aligned region: 12..67
TPR_16 [PF13432], Evalue: 0.0095, Aligned region: 113..137
Protein Sequence: 277 a.a.     [Download]
>gi|84624560|ref|YP_451932.1| hypothetical protein XOO_2903 [Xanthomonas oryzae pv. oryzae MAFF 311018]
MSAVHPEHACARLLKAGDPAQSLATAKDWVRQCPADAQARIGLFQLLAVAGEWQRAQQQLRLAAELDQGW
GGVVAAYVRILDAELEREQVLAGRMMPLMPGQVPPWQQDLLQALQHDRDGEPGQAARRRALALTQADAIA
GHIDGRRFDWLADADPRFGPCLEVILEVGYAWVPFVQLRSLCLEAPTTLRDLLWQSVDIQWHDGTRSRGV
VPCRYPGSQHSEQGAIRLGQRTEWKGEALSACGLGQRLLAGSEDDYPVLDIRHIAFDTAAVEAPWPN
 
Nucleotide Sequence: 834 bp     [Download]
>gi|84621657|ref|NC_007705.1|:c3283094-3282261 Xanthomonas oryzae pv. oryzae MAFF 311018 chromosome, complete genome
ATGTCTGCTGTCCATCCCGAACATGCCTGCGCCCGCCTGCTCAAGGCGGGCGACCCGGCGCAATCGTTGG
CCACCGCCAAGGACTGGGTGCGGCAGTGCCCGGCCGATGCCCAAGCGCGCATCGGGCTGTTCCAACTGTT
GGCGGTGGCCGGAGAGTGGCAGCGCGCGCAACAACAATTGCGCCTGGCCGCGGAGTTGGACCAGGGTTGG
GGCGGGGTCGTGGCTGCGTATGTGCGCATCCTCGACGCTGAACTGGAACGCGAACAGGTGCTGGCCGGCC
GAATGATGCCGCTGATGCCTGGTCAGGTCCCGCCGTGGCAGCAGGATCTGCTGCAGGCATTGCAGCATGA
TCGCGACGGCGAACCAGGGCAGGCAGCGCGACGGCGTGCCCTGGCGCTTACGCAAGCCGATGCCATCGCT
GGCCATATCGATGGCCGGCGTTTCGACTGGCTGGCCGACGCCGACCCGCGTTTTGGTCCGTGCCTTGAGG
TCATCCTCGAAGTGGGCTACGCGTGGGTGCCGTTCGTCCAATTGCGCAGCCTGTGCTTGGAAGCCCCGAC
CACGCTGCGCGACTTGCTATGGCAGTCGGTCGACATCCAATGGCATGACGGCACACGCAGCCGTGGCGTG
GTGCCGTGCCGTTACCCCGGTAGCCAACACAGCGAGCAGGGCGCGATCCGCCTTGGCCAGCGCACCGAAT
GGAAGGGCGAGGCGTTGTCCGCATGCGGTCTGGGGCAACGCTTGCTGGCTGGCAGCGAGGACGACTACCC
GGTGCTCGACATCCGCCACATCGCATTCGACACCGCCGCGGTGGAAGCGCCATGGCCGAACTGA