SecReT6
Protein ID: 84624561
SecReT6 ID116
T6SS typei3
Gene symbol-
Locus tagXOO_2904
StrainXanthomonas oryzae pv. oryzae MAFF 311018
Repliconchromosome [GenBank: NC_007705] [Browse all T6SS(s) in this replicon]
Location [Strand]3283130..3283633 [-]
Producthypothetical protein
NoteTssD
UniProt IDQ2P1B8
KEGG IDxom:XOO_2904
PDB IDNA
Domain hit(s) vs Pfam DUF796 [PF05638], Evalue: 5.00E-36, Aligned region: 7..141
Protein Sequence: 167 a.a.     [Download]
>gi|84624561|ref|YP_451933.1| hypothetical protein XOO_2904 [Xanthomonas oryzae pv. oryzae MAFF 311018]
MAFDMHLKFGSGDVEIKGASNHTKHKDQVPIIAWSWGTSNTGNLHTGAGYAAGGKANVKDISITKYVDSC
SNALLNACCTGARVDSATLYVTNATGEQSDYVTIELSEGVMITSVSTGGSGGEDRLTENVTLHFGKFKYS
FQPQDDKGKKQGGTKDFTFNMQEVKKS
 
Nucleotide Sequence: 504 bp     [Download]
>gi|84621657|ref|NC_007705.1|:c3283633-3283130 Xanthomonas oryzae pv. oryzae MAFF 311018 chromosome, complete genome
ATGGCTTTCGATATGCATCTCAAATTCGGCTCGGGCGACGTCGAGATCAAGGGCGCGTCCAACCATACCA
AGCACAAGGACCAAGTGCCGATCATTGCCTGGTCGTGGGGCACCAGCAACACCGGCAACCTGCATACCGG
CGCCGGGTATGCAGCCGGCGGCAAGGCCAATGTGAAGGATATTTCCATCACCAAGTACGTCGATAGTTGC
TCCAATGCCTTGCTCAACGCCTGCTGCACGGGTGCGCGTGTGGATTCGGCCACGCTGTACGTCACCAACG
CCACCGGCGAGCAGTCGGACTACGTGACGATCGAACTCAGCGAAGGCGTGATGATCACCTCGGTGTCCAC
CGGCGGTAGCGGTGGCGAGGACCGTCTGACCGAAAACGTGACCCTGCATTTCGGCAAGTTCAAGTATTCG
TTCCAGCCGCAGGACGACAAGGGCAAGAAGCAGGGCGGCACCAAGGACTTCACGTTCAACATGCAGGAAG
TGAAGAAGTCCTGA