SecReT6
Protein ID: 84624562
SecReT6 ID116
T6SS typei3
Gene symbol-
Locus tagXOO_2905
StrainXanthomonas oryzae pv. oryzae MAFF 311018
Repliconchromosome [GenBank: NC_007705] [Browse all T6SS(s) in this replicon]
Location [Strand]3283733..3285304 [-]
Producthypothetical protein
NoteTssC
UniProt IDQ2P1B7
KEGG IDxom:XOO_2905
PDB IDNA
Domain hit(s) vs Pfam DUF877 [PF05943], Evalue: 1.20E-192, Aligned region: 92..518
Protein Sequence: 523 a.a.     [Download]
>gi|84624562|ref|YP_451934.1| hypothetical protein XOO_2905 [Xanthomonas oryzae pv. oryzae MAFF 311018]
MRSRIPPCCVRWSRLPSRRMRNLMVTQHSAAQDLAEAQPQTSQTDDFAALLTREFRPRSERAGEEVRLAV
RTLAEQVLERSDIISDDLAQTINAYVAEIDRKISEQLNLILHAPQFQALEGAWRGLHYLVSNTESDTQLK
IRVLNVSKRELAKNLKRFKGTAWDQSPVFKKIYEAEYGQLGGEPYGCLIGDYHFDHSPQDVDTLRGISQI
AAASHAPFIAAAGPGLMGMESWSELSNPRDLAKIFSTPDYAAWRSLRQSEDAKYLALAMPRTLARLPYGV
KTDPVEAFDFEEDTQGADSSCYTWQNAAYAMAVNINRSFKQYGWCTRIRGVESGGAVEGLPTHTFPADDG
GVDMKCPTEVAITDRRSAELDKMGLMPLVHRKNTDMAAFISAQSLGKPEEYDDPDATANAALSARLPYMF
ACCRFAHYLKCIVRDKIGSFSTRQQMQSWLTDWVMNYVDGDPANSSEETKARKPLAAAEVVVEEVEGNPG
YYTSKFFLRPHYQLEGLTVSLRLVSRLPSAQAA
 
Nucleotide Sequence: 1572 bp     [Download]
>gi|84621657|ref|NC_007705.1|:c3285304-3283733 Xanthomonas oryzae pv. oryzae MAFF 311018 chromosome, complete genome
ATGCGATCAAGGATCCCACCCTGCTGCGTTCGCTGGTCGCGGCTCCCAAGTCGAAGGATGCGTAACCTCA
TGGTGACCCAACATTCCGCTGCCCAAGACCTTGCCGAAGCGCAGCCGCAAACCAGTCAGACCGACGACTT
TGCGGCCCTGCTGACCCGCGAATTCCGTCCGCGTAGCGAACGCGCCGGCGAAGAAGTGCGGTTGGCTGTG
CGCACCTTGGCCGAACAGGTGCTGGAACGCAGCGACATCATCAGCGACGACCTCGCGCAGACAATCAACG
CGTATGTCGCCGAGATCGACCGCAAGATCAGCGAGCAACTCAACCTCATCCTGCACGCCCCGCAATTCCA
GGCGCTGGAGGGTGCATGGCGCGGACTGCATTATCTGGTCAGCAACACCGAATCGGACACGCAGTTGAAG
ATCCGCGTGCTCAACGTGTCCAAAAGGGAGCTCGCCAAGAACCTCAAGCGCTTCAAGGGCACCGCCTGGG
ACCAGAGCCCGGTATTCAAGAAAATTTACGAAGCCGAGTACGGCCAGCTGGGTGGCGAACCCTACGGCTG
TTTGATTGGCGATTACCACTTCGACCATAGCCCGCAGGATGTCGACACGCTGCGCGGCATCAGCCAGATT
GCCGCCGCCTCGCATGCGCCTTTCATCGCCGCTGCGGGTCCTGGCCTGATGGGGATGGAAAGCTGGAGCG
AGCTGTCCAACCCGCGCGATCTGGCCAAGATTTTTTCCACCCCCGATTACGCGGCTTGGCGTTCGTTGCG
TCAGAGCGAGGATGCCAAGTACCTGGCGCTTGCCATGCCGCGCACGCTGGCGCGGCTGCCGTACGGAGTC
AAGACCGATCCGGTGGAAGCGTTCGACTTCGAAGAAGACACCCAGGGCGCCGATTCGTCGTGCTACACCT
GGCAAAACGCCGCCTACGCGATGGCGGTCAACATCAACCGCTCCTTCAAGCAGTACGGTTGGTGCACCCG
CATTCGCGGCGTGGAGTCGGGTGGGGCGGTGGAAGGCCTGCCGACGCATACCTTCCCGGCCGACGATGGC
GGTGTGGACATGAAGTGCCCGACCGAGGTCGCGATTACCGACCGCCGTTCGGCCGAACTCGACAAGATGG
GTCTGATGCCGCTGGTACATCGCAAGAACACCGACATGGCAGCCTTCATCAGCGCGCAGTCGCTGGGCAA
GCCCGAGGAATACGACGACCCGGATGCCACCGCCAACGCGGCGCTGAGCGCACGCCTGCCGTATATGTTC
GCTTGCTGCCGCTTCGCGCACTATTTGAAGTGCATCGTGCGCGACAAGATCGGCTCGTTCAGCACGCGCC
AGCAGATGCAGAGCTGGTTGACCGATTGGGTGATGAACTACGTCGACGGCGACCCGGCCAATTCCAGCGA
AGAAACCAAGGCGCGTAAGCCATTGGCTGCTGCCGAAGTGGTCGTCGAAGAGGTCGAGGGCAACCCCGGC
TACTACACCTCCAAGTTCTTCCTGCGCCCGCATTACCAGCTCGAAGGCCTGACGGTATCGCTACGCCTGG
TCTCGCGCTTGCCATCGGCGCAGGCAGCCTGA