SecReT6
Protein ID: 84624563
SecReT6 ID116
T6SS typei3
Gene symbol-
Locus tagXOO_2906
StrainXanthomonas oryzae pv. oryzae MAFF 311018
Repliconchromosome [GenBank: NC_007705] [Browse all T6SS(s) in this replicon]
Location [Strand]3285240..3285875 [-]
Producthypothetical protein
NoteTssB
UniProt IDQ2P1B6
KEGG IDxom:XOO_2906
PDB IDNA
Domain hit(s) vs Pfam DUF770 [PF05591], Evalue: 6.60E-55, Aligned region: 54..207
Protein Sequence: 211 a.a.     [Download]
>gi|84624563|ref|YP_451935.1| hypothetical protein XOO_2906 [Xanthomonas oryzae pv. oryzae MAFF 311018]
MPVFDFIPPAAAHTMHLRCKGDAFATWPLQPQRPATTQIIGGRMSVRSSSQKFIARNRAPRVQIEYDVEI
YGSQKKVQVPFVMGVLSDLSGANTEHLPALEAREAVEMDVDNFDSRLRAMQPRVAMSVSNTLTGSGELPV
DITFDSLDDFSPTAVVKKVAPLAELLEARTQLANLGTYLDGKAGAERLIADAIKDPTLLRSLVAAPKSKD
A
 
Nucleotide Sequence: 636 bp     [Download]
>gi|84621657|ref|NC_007705.1|:c3285875-3285240 Xanthomonas oryzae pv. oryzae MAFF 311018 chromosome, complete genome
ATGCCGGTGTTCGATTTCATTCCGCCGGCAGCAGCGCACACGATGCATCTCCGGTGCAAGGGGGACGCCT
TTGCCACATGGCCGCTGCAACCGCAGCGTCCAGCAACCACGCAGATCATCGGAGGCCGCATGTCCGTTCG
CAGCAGCAGTCAGAAGTTCATTGCCAGAAATCGCGCGCCTCGCGTGCAGATCGAGTACGACGTCGAGATT
TACGGCTCGCAGAAAAAGGTGCAGGTTCCGTTCGTCATGGGTGTGTTGTCGGATCTGTCCGGCGCCAATA
CCGAACACCTGCCGGCGCTGGAAGCACGCGAGGCAGTGGAAATGGATGTCGACAATTTCGACAGCCGGCT
GCGTGCCATGCAACCGCGCGTGGCCATGAGCGTTTCCAATACGCTCACCGGCAGCGGCGAGTTACCGGTC
GATATCACCTTCGACAGCCTGGACGATTTTTCGCCCACCGCGGTCGTGAAAAAGGTGGCACCGCTGGCCG
AGCTGCTGGAAGCACGTACCCAGCTGGCCAATCTAGGCACTTACCTTGACGGCAAAGCCGGCGCCGAGCG
CTTGATCGCCGATGCGATCAAGGATCCCACCCTGCTGCGTTCGCTGGTCGCGGCTCCCAAGTCGAAGGAT
GCGTAA