SecReT6
Protein ID: 84624943
SecReT6 ID117
T6SS typei4b
Gene symbol-
Locus tagXOO_3286
StrainXanthomonas oryzae pv. oryzae MAFF 311018
Repliconchromosome [GenBank: NC_007705] [Browse all T6SS(s) in this replicon]
Location [Strand]3735707..3738469 [-]
ProductVGR-like protein
NoteTssI
UniProt IDQ2P086
KEGG IDxom:XOO_3286
PDB IDNA
Domain hit(s) vs Pfam Phage_GPD [PF05954], Evalue: 2.60E-71, Aligned region: 41..355
Phage_GPD [PF05954], Evalue: 2.60E-71, Aligned region: 810..861
DUF2345 [PF10106], Evalue: 1.40E-36, Aligned region: 723..886
T6SS_Vgr [PF13296], Evalue: 8.10E-27, Aligned region: 200..237
T6SS_Vgr [PF13296], Evalue: 8.10E-27, Aligned region: 293..323
T6SS_Vgr [PF13296], Evalue: 8.10E-27, Aligned region: 579..683
T6SS_Vgr [PF13296], Evalue: 8.10E-27, Aligned region: 775..799
Phage_base_V [PF04717], Evalue: 2.10E-19, Aligned region: 225..250
Phage_base_V [PF04717], Evalue: 2.10E-19, Aligned region: 434..537
Protein Sequence: 920 a.a.     [Download]
>gi|84624943|ref|YP_452315.1| VGR-like protein [Xanthomonas oryzae pv. oryzae MAFF 311018]
MDPVATVLSALSAAPHQQERLLRLHTPLGPDVLVAETLDGRESVDGGGFRFDVGALSANAGLPLDDLLGQ
PVLLELLTAESRTALRPFHGHVTAFERLGSNGGLARYRLRVEPWLALLAQRVDSYVFQDMSVVEIAESVF
ADYAGQGALAPAWRWELSDRSTYARRSLTTQYEETDFAFLSRLLAEEGIAYWFEHTGAADSATRGTHTLV
LSDHNAAFADLGTVRYHRTDVTEQQDSVQQWVQAHRWRATSLSRASWDYRSRSLRLAGAEATPLGDIGAE
DVDTAGPYGWQDSTRGQRRAQQQFDAQQVTAQTIQGQGTWRQLAPGTRFGLRQHAGVAADAAFLCLQVRH
QARNNLGAEVFDALEQALGAVAVAGAPLPPALAGLSGGYAPAQDEAAVEFYRNQFTAIPATATYRPQTED
GHGVRLHPKPTVVGTLSAIVVSDGDPVQSDRDHRIKVQFPFQRGADASSALAHPGGEDNAPGSASAWTWV
RVMTPWAGDNWGGVVLPRKGQEVLVGFLEGDIDRPVVIGSVYNGRGQDDAAHNQVGGGGAGATGNAPAWF
QGNAHGAVFTGFKSQALAQSQDGTGGYQQLRLDDTPGQGRAQLSTTQHASTLTLGHLKGGHDNLREGERG
YGADLSTQAYGAVRAGQGLLLSSEPGNTQLAATGALSQLQQGSDLLKRLNDAARTQQAGLPSEPESLPTQ
DGLKTLQDHLQATHSGSAAGAIGGGTGEVPGWSAPVLLGSGQAGVMSLTPADQVWVSGTQTALLAGSALN
WLSQGHLVLAVAGGLVLYTQGSKAAAGSPNQETGIALHAAQGTLSARAHRSTAILAAKTQVRIVSTTADV
QLAAPTRHLLATAAGAYIKLDGDDIELGAPGVVAFKGGQQVLTGPQGASMSPVTPSASHKLCEYTARAAD
FAGAGTMGAA
 
Nucleotide Sequence: 2763 bp     [Download]
>gi|84621657|ref|NC_007705.1|:c3738469-3735707 Xanthomonas oryzae pv. oryzae MAFF 311018 chromosome, complete genome
ATGGACCCGGTCGCCACAGTACTTTCCGCCCTCAGCGCCGCCCCGCACCAGCAAGAACGCCTGCTGCGGT
TGCACACCCCGCTGGGCCCCGACGTGCTGGTCGCAGAGACGCTCGACGGCCGCGAGTCGGTCGATGGCGG
CGGCTTCCGTTTCGACGTGGGCGCACTATCGGCCAACGCCGGCCTGCCCCTGGACGACCTGCTCGGCCAG
CCGGTGTTGCTGGAACTGCTCACCGCCGAGTCGCGCACCGCGCTGCGCCCGTTCCACGGCCATGTCACCG
CGTTCGAGCGGCTGGGCAGCAACGGGGGCCTGGCGCGCTACCGGCTGCGGGTGGAGCCATGGCTGGCGCT
GCTGGCCCAGCGCGTGGACAGCTACGTGTTCCAGGACATGAGCGTGGTGGAGATCGCCGAGAGCGTGTTC
GCCGACTACGCCGGGCAAGGCGCGCTGGCGCCGGCGTGGCGCTGGGAGCTGTCCGACCGCAGCACGTACG
CCAGGCGCAGCCTGACCACGCAATACGAAGAGACCGACTTCGCGTTCCTGAGCCGGCTGCTGGCCGAGGA
AGGCATCGCCTATTGGTTCGAGCACACCGGCGCGGCCGACAGCGCCACGCGCGGCACGCACACGCTGGTG
CTGTCGGACCACAACGCCGCCTTCGCCGACCTGGGCACGGTGCGCTACCACCGCACCGACGTCACCGAGC
AGCAGGACAGCGTGCAGCAGTGGGTACAGGCACATCGCTGGCGCGCGACCAGTCTGTCGCGGGCCAGCTG
GGACTACCGCAGCCGCAGCCTGCGCCTGGCCGGCGCCGAGGCCACGCCGCTGGGCGACATCGGTGCCGAG
GACGTGGACACCGCCGGCCCCTACGGCTGGCAGGACAGCACGCGCGGCCAGCGCCGCGCGCAGCAGCAGT
TCGATGCGCAGCAGGTGACGGCGCAGACCATCCAGGGCCAGGGGACCTGGCGGCAACTGGCACCGGGCAC
ACGTTTCGGGCTGCGCCAGCATGCGGGCGTGGCGGCCGATGCGGCGTTCCTGTGCCTGCAGGTGCGGCAC
CAGGCGCGCAACAACCTGGGCGCGGAGGTGTTCGACGCGCTGGAGCAGGCGCTGGGCGCGGTGGCGGTGG
CCGGCGCGCCGCTGCCGCCAGCGCTGGCAGGCCTGAGCGGCGGGTATGCGCCGGCGCAGGATGAGGCGGC
GGTAGAGTTCTACCGCAACCAGTTCACCGCCATACCGGCCACCGCGACCTACCGGCCGCAAACCGAGGAC
GGCCACGGCGTGCGCCTGCATCCCAAGCCCACGGTGGTCGGCACGCTGAGCGCCATCGTGGTCAGCGACG
GCGACCCGGTGCAGTCCGACCGCGACCACCGGATCAAGGTGCAGTTCCCGTTCCAGCGCGGGGCCGACGC
CAGCAGCGCGCTGGCGCATCCGGGGGGCGAGGACAACGCGCCGGGCAGCGCCTCGGCGTGGACCTGGGTG
CGGGTGATGACGCCGTGGGCCGGCGACAACTGGGGCGGCGTGGTGCTGCCGCGCAAGGGCCAGGAAGTGC
TGGTGGGGTTCCTGGAAGGGGACATCGACCGGCCGGTGGTGATCGGCAGCGTGTACAACGGGCGCGGCCA
GGACGACGCGGCGCACAACCAGGTCGGCGGCGGCGGGGCCGGGGCCACCGGCAATGCGCCGGCGTGGTTC
CAGGGCAACGCGCACGGTGCGGTGTTCACCGGGTTCAAGAGCCAGGCGCTGGCGCAGAGCCAGGACGGCA
CCGGCGGCTACCAGCAGCTGCGGCTGGACGACACGCCCGGCCAGGGCCGCGCGCAGCTGTCGACCACCCA
GCACGCCAGCACCTTGACCCTGGGCCACCTGAAGGGCGGCCACGACAACCTGCGCGAAGGCGAGCGCGGG
TACGGGGCGGACCTGTCCACGCAGGCCTACGGCGCGGTGCGCGCCGGCCAGGGCCTGCTGCTGAGCAGCG
AGCCGGGCAACACCCAACTGGCCGCCACCGGTGCGCTGAGCCAACTGCAGCAGGGCAGCGACCTGCTCAA
GCGCCTCAACGACGCCGCCCGCACCCAGCAGGCGGGCCTACCGAGCGAACCGGAGTCCCTGCCGACCCAG
GACGGCCTGAAGACCTTGCAGGACCACCTGCAGGCCACCCACAGCGGCAGCGCGGCCGGCGCGATCGGCG
GTGGCACCGGCGAGGTGCCCGGCTGGAGCGCCCCAGTGCTGCTGGGCAGCGGCCAGGCCGGCGTGATGAG
CCTGACCCCGGCCGACCAGGTGTGGGTGTCGGGCACCCAGACCGCGCTGCTGGCCGGCAGCGCACTGAAC
TGGCTGAGCCAGGGCCACCTGGTGCTGGCGGTGGCCGGCGGGCTGGTGCTGTACACCCAGGGCAGCAAGG
CCGCCGCCGGCAGCCCGAATCAGGAAACCGGCATCGCCCTGCACGCCGCGCAAGGCACGCTCAGCGCGCG
CGCGCACAGGAGCACCGCCATCCTGGCCGCCAAGACCCAGGTGCGCATCGTCAGCACCACCGCCGACGTC
CAGCTCGCCGCGCCGACCAGGCACCTGCTGGCCACCGCGGCCGGCGCCTACATCAAGCTGGACGGCGACG
ACATCGAACTGGGCGCGCCGGGGGTGGTCGCGTTCAAGGGCGGGCAGCAGGTGTTGACGGGGCCGCAGGG
GGCATCCATGAGCCCCGTGACGCCATCCGCCAGCCACAAGCTGTGTGAATACACCGCCCGCGCGGCAGAT
TTCGCCGGTGCAGGGACGATGGGGGCCGCCTGA