SecReT6
Protein ID: 84624943
SecReT6 ID117
T6SS typei4b
Gene symbol-
Locus tagXOO_3286
StrainXanthomonas oryzae pv. oryzae MAFF 311018
Repliconchromosome [GenBank: NC_007705] [Browse all T6SS(s) in this replicon]
Location [Strand]3735707..3738469 [-]
ProductVGR-like protein
NoteTssI
UniProt IDQ2P086
KEGG IDxom:XOO_3286
PDB IDNA
Domain hit(s) vs Pfam Phage_GPD [PF05954], Evalue: 2.60E-71, Aligned region: 41..355
Phage_GPD [PF05954], Evalue: 2.60E-71, Aligned region: 810..861
DUF2345 [PF10106], Evalue: 1.40E-36, Aligned region: 723..886
T6SS_Vgr [PF13296], Evalue: 8.10E-27, Aligned region: 200..237
T6SS_Vgr [PF13296], Evalue: 8.10E-27, Aligned region: 293..323
T6SS_Vgr [PF13296], Evalue: 8.10E-27, Aligned region: 579..683
T6SS_Vgr [PF13296], Evalue: 8.10E-27, Aligned region: 775..799
Phage_base_V [PF04717], Evalue: 2.10E-19, Aligned region: 225..250
Phage_base_V [PF04717], Evalue: 2.10E-19, Aligned region: 434..537
Protein Sequence: 920 a.a.     [Download]
>gi|84624943|ref|YP_452315.1| VGR-like protein [Xanthomonas oryzae pv. oryzae MAFF 311018]
MDPVATVLSALSAAPHQQERLLRLHTPLGPDVLVAETLDGRESVDGGGFRFDVGALSANAGLPLDDLLGQ
PVLLELLTAESRTALRPFHGHVTAFERLGSNGGLARYRLRVEPWLALLAQRVDSYVFQDMSVVEIAESVF
ADYAGQGALAPAWRWELSDRSTYARRSLTTQYEETDFAFLSRLLAEEGIAYWFEHTGAADSATRGTHTLV
LSDHNAAFADLGTVRYHRTDVTEQQDSVQQWVQAHRWRATSLSRASWDYRSRSLRLAGAEATPLGDIGAE
DVDTAGPYGWQDSTRGQRRAQQQFDAQQVTAQTIQGQGTWRQLAPGTRFGLRQHAGVAADAAFLCLQVRH
QARNNLGAEVFDALEQALGAVAVAGAPLPPALAGLSGGYAPAQDEAAVEFYRNQFTAIPATATYRPQTED
GHGVRLHPKPTVVGTLSAIVVSDGDPVQSDRDHRIKVQFPFQRGADASSALAHPGGEDNAPGSASAWTWV
RVMTPWAGDNWGGVVLPRKGQEVLVGFLEGDIDRPVVIGSVYNGRGQDDAAHNQVGGGGAGATGNAPAWF
QGNAHGAVFTGFKSQALAQSQDGTGGYQQLRLDDTPGQGRAQLSTTQHASTLTLGHLKGGHDNLREGERG
YGADLSTQAYGAVRAGQGLLLSSEPGNTQLAATGALSQLQQGSDLLKRLNDAARTQQAGLPSEPESLPTQ
DGLKTLQDHLQATHSGSAAGAIGGGTGEVPGWSAPVLLGSGQAGVMSLTPADQVWVSGTQTALLAGSALN
WLSQGHLVLAVAGGLVLYTQGSKAAAGSPNQETGIALHAAQGTLSARAHRSTAILAAKTQVRIVSTTADV
QLAAPTRHLLATAAGAYIKLDGDDIELGAPGVVAFKGGQQVLTGPQGASMSPVTPSASHKLCEYTARAAD
FAGAGTMGAA
 
Nucleotide Sequence: 2763 bp     [Download]
>gi|84621657|ref|NC_007705.1|:c3738469-3735707 Xanthomonas oryzae pv. oryzae MAFF 311018 chromosome, complete genome
ATGGACCCGGTCGCCACAGTACTTTCCGCCCTCAGCGCCGCCCCGCACCAGCAAGAACGCCTGCTGCGGT
TGCACACCCCGCTGGGCCCCGACGTGCTGGTCGCAGAGACGCTCGACGGCCGCGAGTCGGTCGATGGCGG
CGGCTTCCGTTTCGACGTGGGCGCACTATCGGCCAACGCCGGCCTGCCCCTGGACGACCTGCTCGGCCAG
CCGGTGTTGCTGGAACTGCTCACCGCCGAGTCGCGCACCGCGCTGCGCCCGTTCCACGGCCATGTCACCG
CGTTCGAGCGGCTGGGCAGCAACGGGGGCCTGGCGCGCTACCGGCTGCGGGTGGAGCCATGGCTGGCGCT
GCTGGCCCAGCGCGTGGACAGCTACGTGTTCCAGGACATGAGCGTGGTGGAGATCGCCGAGAGCGTGTTC
GCCGACTACGCCGGGCAAGGCGCGCTGGCGCCGGCGTGGCGCTGGGAGCTGTCCGACCGCAGCACGTACG
CCAGGCGCAGCCTGACCACGCAATACGAAGAGACCGACTTCGCGTTCCTGAGCCGGCTGCTGGCCGAGGA
AGGCATCGCCTATTGGTTCGAGCACACCGGCGCGGCCGACAGCGCCACGCGCGGCACGCACACGCTGGTG
CTGTCGGACCACAACGCCGCCTTCGCCGACCTGGGCACGGTGCGCTACCACCGCACCGACGTCACCGAGC
AGCAGGACAGCGTGCAGCAGTGGGTACAGGCACATCGCTGGCGCGCGACCAGTCTGTCGCGGGCCAGCTG
GGACTACCGCAGCCGCAGCCTGCGCCTGGCCGGCGCCGAGGCCACGCCGCTGGGCGACATCGGTGCCGAG
GACGTGGACACCGCCGGCCCCTACGGCTGGCAGGACAGCACGCGCGGCCAGCGCCGCGCGCAGCAGCAGT
TCGATGCGCAGCAGGTGACGGCGCAGACCATCCAGGGCCAGGGGACCTGGCGGCAACTGGCACCGGGCAC
ACGTTTCGGGCTGCGCCAGCATGCGGGCGTGGCGGCCGATGCGGCGTTCCTGTGCCTGCAGGTGCGGCAC
CAGGCGCGCAACAACCTGGGCGCGGAGGTGTTCGACGCGCTGGAGCAGGCGCTGGGCGCGGTGGCGGTGG
CCGGCGCGCCGCTGCCGCCAGCGCTGGCAGGCCTGAGCGGCGGGTATGCGCCGGCGCAGGATGAGGCGGC
GGTAGAGTTCTACCGCAACCAGTTCACCGCCATACCGGCCACCGCGACCTACCGGCCGCAAACCGAGGAC
GGCCACGGCGTGCGCCTGCATCCCAAGCCCACGGTGGTCGGCACGCTGAGCGCCATCGTGGTCAGCGACG
GCGACCCGGTGCAGTCCGACCGCGACCACCGGATCAAGGTGCAGTTCCCGTTCCAGCGCGGGGCCGACGC
CAGCAGCGCGCTGGCGCATCCGGGGGGCGAGGACAACGCGCCGGGCAGCGCCTCGGCGTGGACCTGGGTG
CGGGTGATGACGCCGTGGGCCGGCGACAACTGGGGCGGCGTGGTGCTGCCGCGCAAGGGCCAGGAAGTGC
TGGTGGGGTTCCTGGAAGGGGACATCGACCGGCCGGTGGTGATCGGCAGCGTGTACAACGGGCGCGGCCA
GGACGACGCGGCGCACAACCAGGTCGGCGGCGGCGGGGCCGGGGCCACCGGCAATGCGCCGGCGTGGTTC
CAGGGCAACGCGCACGGTGCGGTGTTCACCGGGTTCAAGAGCCAGGCGCTGGCGCAGAGCCAGGACGGCA
CCGGCGGCTACCAGCAGCTGCGGCTGGACGACACGCCCGGCCAGGGCCGCGCGCAGCTGTCGACCACCCA
GCACGCCAGCACCTTGACCCTGGGCCACCTGAAGGGCGGCCACGACAACCTGCGCGAAGGCGAGCGCGGG
TACGGGGCGGACCTGTCCACGCAGGCCTACGGCGCGGTGCGCGCCGGCCAGGGCCTGCTGCTGAGCAGCG
AGCCGGGCAACACCCAACTGGCCGCCACCGGTGCGCTGAGCCAACTGCAGCAGGGCAGCGACCTGCTCAA
GCGCCTCAACGACGCCGCCCGCACCCAGCAGGCGGGCCTACCGAGCGAACCGGAGTCCCTGCCGACCCAG
GACGGCCTGAAGACCTTGCAGGACCACCTGCAGGCCACCCACAGCGGCAGCGCGGCCGGCGCGATCGGCG
GTGGCACCGGCGAGGTGCCCGGCTGGAGCGCCCCAGTGCTGCTGGGCAGCGGCCAGGCCGGCGTGATGAG
CCTGACCCCGGCCGACCAGGTGTGGGTGTCGGGCACCCAGACCGCGCTGCTGGCCGGCAGCGCACTGAAC
TGGCTGAGCCAGGGCCACCTGGTGCTGGCGGTGGCCGGCGGGCTGGTGCTGTACACCCAGGGCAGCAAGG
CCGCCGCCGGCAGCCCGAATCAGGAAACCGGCATCGCCCTGCACGCCGCGCAAGGCACGCTCAGCGCGCG
CGCGCACAGGAGCACCGCCATCCTGGCCGCCAAGACCCAGGTGCGCATCGTCAGCACCACCGCCGACGTC
CAGCTCGCCGCGCCGACCAGGCACCTGCTGGCCACCGCGGCCGGCGCCTACATCAAGCTGGACGGCGACG
ACATCGAACTGGGCGCGCCGGGGGTGGTCGCGTTCAAGGGCGGGCAGCAGGTGTTGACGGGGCCGCAGGG
GGCATCCATGAGCCCCGTGACGCCATCCGCCAGCCACAAGCTGTGTGAATACACCGCCCGCGCGGCAGAT
TTCGCCGGTGCAGGGACGATGGGGGCCGCCTGA

Protein ID: 84624956
SecReT6 ID117
T6SS typei4b
Gene symbol-
Locus tagXOO_3299
StrainXanthomonas oryzae pv. oryzae MAFF 311018
Repliconchromosome [GenBank: NC_007705] [Browse all T6SS(s) in this replicon]
Location [Strand]3751746..3754463 [+]
ProductVGR-like protein
NoteTssI
UniProt IDQ2P073
KEGG IDxom:XOO_3299
PDB IDNA
Domain hit(s) vs Pfam Phage_GPD [PF05954], Evalue: 5.10E-57, Aligned region: 41..342
Phage_GPD [PF05954], Evalue: 5.10E-57, Aligned region: 618..772
Phage_GPD [PF05954], Evalue: 5.10E-57, Aligned region: 785..817
DUF2345 [PF10106], Evalue: 4.20E-49, Aligned region: 233..286
DUF2345 [PF10106], Evalue: 4.20E-49, Aligned region: 580..612
DUF2345 [PF10106], Evalue: 4.20E-49, Aligned region: 667..819
T6SS_Vgr [PF13296], Evalue: 2.40E-30, Aligned region: 515..621
T6SS_Vgr [PF13296], Evalue: 2.40E-30, Aligned region: 698..718
Phage_base_V [PF04717], Evalue: 3.40E-16, Aligned region: 386..495
Protein Sequence: 905 a.a.     [Download]
>gi|84624956|ref|YP_452328.1| VGR-like protein [Xanthomonas oryzae pv. oryzae MAFF 311018]
MDIPTLAVALASLAQPSQHARLIQLRAPVEGLVVERFHGQEAVCGATVLQIACLATSAFLDAEALLEQPL
DLQLRQADGTQRHWQGLCTEVAQLGGDGGLARYRLTLAPWTALLELRRNALVFQDLDARAICERIFADYP
QAAFRFDVQAALPAHPITTQYRETDWAFVTRLLAEAGLAWRYAHAQDADSQATAATLVIFDPQAQVPDSG
TIRFHRSDLAEADDAIGAFGERRGVVPTASTVTSWHSEQVRAVGAQAQAEAGGLPPLEVYVQPRAGRFAQ
EATAQDQAQARLDALRVPHTLHAGAGSARVLAAGAAFTLRQHAQHDGQRFVPVAIEHVAVNNLGQGIVAL
LDAPELEHGSYRNRFLAVPAATPLRALPQDRPRMPGPQSARVVGVADAALSPSRDHQVRIQFPWQRGDQP
TPGGLTDSASTAPGHAPGDQRAGTWVPVAEWVAGPNWGSHFLPRIGSEVLVEFLHGDIDQPRITGQLYNG
EVAPPFGGGLDARASHPGTLSGLHTQSHDGSGTQQWLLDDTPGQLRTRLHTSLADTRLELGYLVQHSDTA
RGALRGQGFELASQGWGNVHAAQGLLLSSSARGQGASTALDVAEAVAQLHGAQRTAQALHATLTQQQVPG
LDAHPSVTQLREAIDPQAQGKYTAAVGGQAATKPADGGRDGQAPVERFAQARLLGESPDHIAWTTPASAV
AYAGQALQLTVQQDAQLSAGQTLSAVSGQHTALFAQRGPIKLIAAAGPVSLQAHTGALELLADQAVTVTA
TDTRIDVLAQHKIVLQAGQTRITLEGGDITFACPGQFTVKASTHPFLGGEMNVAPLSALPGSLISDFGYD
EQFRLVADDGETPLSRCRYRITGNNGDAWEGIADEDGLTERVFTLVPTKLDVEIIGSSDDTEVIT
 
Nucleotide Sequence: 2718 bp     [Download]
>gi|84621657|ref|NC_007705.1|:3751746-3754463 Xanthomonas oryzae pv. oryzae MAFF 311018 chromosome, complete genome
ATGGATATCCCGACACTGGCCGTCGCCCTGGCTAGTCTGGCGCAGCCGTCCCAACATGCCCGCCTGATCC
AACTGCGCGCCCCGGTCGAGGGGCTGGTGGTGGAACGCTTCCACGGGCAGGAGGCGGTGTGCGGCGCCAC
CGTGCTGCAGATCGCGTGCCTGGCCACCTCGGCGTTTCTCGATGCCGAGGCGCTGCTGGAGCAGCCACTG
GACCTGCAGCTGCGCCAGGCCGACGGCACGCAACGCCACTGGCAGGGCCTGTGCACCGAAGTGGCGCAAC
TGGGCGGCGACGGCGGCCTGGCCCGCTACCGGCTGACCCTGGCGCCGTGGACGGCGCTGCTGGAGCTGCG
GCGCAACGCACTGGTGTTCCAGGACCTGGACGCGCGCGCGATTTGCGAACGGATCTTCGCCGACTACCCG
CAGGCCGCGTTCCGCTTCGACGTGCAGGCCGCGTTGCCGGCGCACCCGATCACCACCCAATACCGCGAGA
CCGACTGGGCCTTCGTCACCCGCCTGCTGGCCGAGGCCGGCCTGGCCTGGCGCTACGCGCACGCGCAGGA
CGCCGACAGCCAGGCCACCGCGGCCACGCTGGTGATCTTCGACCCGCAGGCGCAGGTGCCGGACAGCGGC
ACGATCCGCTTCCACCGCAGCGACCTGGCCGAGGCCGACGATGCGATCGGCGCCTTCGGCGAGCGCCGCG
GCGTCGTGCCCACCGCCAGCACGGTGACCAGCTGGCACAGCGAACAAGTGCGCGCGGTCGGCGCGCAGGC
CCAGGCCGAGGCCGGCGGGCTGCCGCCGCTGGAGGTCTACGTGCAGCCGCGCGCCGGGCGTTTCGCCCAG
GAAGCGACCGCGCAGGATCAGGCGCAGGCGCGGCTGGACGCGCTGCGCGTGCCGCACACGCTGCACGCCG
GGGCCGGCAGCGCCCGCGTGCTGGCGGCCGGGGCGGCGTTCACCTTGCGCCAGCACGCCCAGCACGACGG
CCAGCGTTTCGTTCCGGTGGCGATCGAGCACGTGGCGGTGAACAACCTGGGCCAGGGCATCGTCGCCCTG
CTGGACGCGCCGGAGCTGGAGCACGGCAGCTACCGCAACCGCTTCCTGGCGGTGCCGGCGGCCACGCCGC
TGCGCGCGCTGCCGCAGGACCGCCCGCGCATGCCCGGGCCGCAGAGCGCGCGCGTGGTCGGCGTGGCCGA
CGCGGCGCTGAGCCCGAGCCGCGACCACCAGGTGCGGATCCAGTTCCCGTGGCAGCGCGGCGACCAGCCC
ACCCCGGGCGGGTTGACCGACAGCGCCAGCACCGCGCCCGGCCACGCGCCGGGCGACCAGCGCGCCGGCA
CCTGGGTGCCGGTGGCCGAGTGGGTGGCCGGCCCGAACTGGGGCAGCCACTTCCTGCCGCGCATCGGCAG
CGAAGTGCTGGTGGAGTTCCTGCACGGGGACATCGATCAGCCGCGCATCACCGGCCAGTTGTACAACGGC
GAGGTCGCCCCACCCTTCGGCGGCGGCCTGGACGCGCGTGCCAGCCATCCCGGCACGCTCAGCGGCCTGC
ACACCCAGTCCCACGACGGCAGCGGCACCCAGCAATGGCTGCTGGACGACACCCCCGGCCAGCTGCGCAC
GCGCCTGCACACCTCGCTGGCCGACACCCGGCTGGAACTGGGCTACCTGGTCCAGCACAGCGACACCGCC
CGCGGCGCGCTGCGCGGCCAGGGCTTCGAACTGGCCTCCCAGGGCTGGGGCAACGTGCATGCCGCGCAAG
GCCTGCTGCTGTCCAGCAGCGCCCGCGGCCAGGGCGCCTCGACCGCATTGGACGTGGCCGAGGCGGTGGC
CCAGTTGCACGGCGCCCAACGCACCGCTCAGGCGCTGCACGCCACCCTGACCCAGCAACAGGTGCCCGGC
CTGGACGCCCATCCCAGCGTGACCCAACTGCGCGAGGCCATCGACCCGCAGGCGCAGGGCAAGTACACCG
CTGCGGTCGGCGGCCAGGCGGCGACCAAGCCAGCCGACGGCGGCCGCGACGGCCAGGCACCGGTGGAACG
CTTCGCCCAGGCGCGCCTGCTCGGCGAGTCGCCGGACCACATCGCCTGGACCACCCCGGCCAGCGCGGTG
GCCTATGCCGGGCAGGCCCTGCAATTGACCGTGCAGCAGGATGCGCAGCTGAGCGCCGGGCAGACCCTGT
CGGCGGTGTCCGGCCAGCACACCGCGCTGTTCGCCCAACGCGGACCGATCAAACTCATCGCCGCCGCCGG
CCCGGTGAGCCTGCAGGCGCATACCGGCGCGCTGGAACTGCTGGCCGACCAGGCGGTGACCGTCACCGCC
ACCGACACCCGCATCGACGTGCTGGCGCAGCACAAGATCGTGCTGCAGGCCGGACAGACCCGCATCACCC
TGGAAGGCGGCGACATCACCTTCGCCTGCCCGGGGCAGTTCACGGTCAAGGCCAGCACGCATCCGTTCTT
GGGTGGGGAGATGAATGTAGCCCCGCTCTCTGCCTTACCAGGCTCACTGATATCAGACTTCGGCTACGAC
GAGCAATTCCGTCTTGTAGCTGACGACGGAGAAACTCCCCTTTCAAGATGTCGTTACAGGATCACGGGGA
ACAATGGAGACGCCTGGGAAGGGATTGCCGACGAGGACGGACTGACAGAAAGAGTCTTCACCTTAGTCCC
CACAAAACTCGATGTAGAAATAATTGGAAGTTCTGACGATACGGAGGTGATCACATGA

Protein ID: 84624957
SecReT6 ID117
T6SS typei4b
Gene symbol-
Locus tagXOO_3300
StrainXanthomonas oryzae pv. oryzae MAFF 311018
Repliconchromosome [GenBank: NC_007705] [Browse all T6SS(s) in this replicon]
Location [Strand]3755996..3757966 [+]
ProductVGR-like protein
NoteTssI
UniProt IDQ2P072
KEGG IDxom:XOO_3300
PDB IDNA
Domain hit(s) vs Pfam Phage_GPD [PF05954], Evalue: 1.20E-34, Aligned region: 5..219
Phage_GPD [PF05954], Evalue: 1.20E-34, Aligned region: 495..636
T6SS_Vgr [PF13296], Evalue: 1.50E-30, Aligned region: 392..498
T6SS_Vgr [PF13296], Evalue: 1.50E-30, Aligned region: 575..595
DUF2345 [PF10106], Evalue: 1.00E-29, Aligned region: 102..184
DUF2345 [PF10106], Evalue: 1.00E-29, Aligned region: 457..490
DUF2345 [PF10106], Evalue: 1.00E-29, Aligned region: 544..651
Phage_base_V [PF04717], Evalue: 1.70E-16, Aligned region: 263..372
Protein Sequence: 656 a.a.     [Download]
>gi|84624957|ref|YP_452329.1| VGR-like protein [Xanthomonas oryzae pv. oryzae MAFF 311018]
MPEDARAICERIFADYPQAAFRFDVQAALPAHPITTQYRETDWAFVTRLLAEAGLAWRYAHAQDADSQAT
AATLVIFDPQAQAPDSGTIRFHRSDLAEADDAIGAFGERRGVVPTASTVTSWHSEQVRAVGAQAQAEAGA
LPPLEVYVQPRAGRFAQEATAQDQAQARLDALRVPHTLHAGAGSARVLAAGAAFTLRQHAQHDGQRFVPV
AIEHVAVNNLGQGIVALLDAPELEHGSYRNRFLAVPAATPLRALPQDRPRMPGPQSARVVGVADAALSPS
RDHQVRIQFPWQRGDQPAPGGLTDSASTAPGHAPGDQRAGTWVPVAEWVAGPNWGSHFLPRIGSEVLVEF
LHGDIDQPRITGQLYNGELAPPFGGGLDAHASHPGTLSGLHTQSHDGSGTQQWLLDDTPGQLRTRLHTSL
ADTRLELGYLVQHSDTARGALRGQGFELASQGWGNVHAAQGLLLSSSARGQGASTALDVAEAVAQLHGAQ
RTAQALHATLTQQQVPGLDAHPSVTRLREAIDPQAQGKYTAAVGGQAATKPADGGRDGQAPVERFAQARL
LGESPDHIAWTTPASAVAYAGQALQLTVQQDAQLSAGQTLSAVSGQHTALFAQRGPIKLIAAAGPVSLQA
HTGALELLADQAVTVTATDTDTRASC
 
Nucleotide Sequence: 1971 bp     [Download]
>gi|84621657|ref|NC_007705.1|:3755996-3757966 Xanthomonas oryzae pv. oryzae MAFF 311018 chromosome, complete genome
ATGCCTGAGGACGCGCGCGCGATCTGCGAACGGATCTTCGCCGACTACCCGCAGGCCGCGTTCCGCTTCG
ACGTGCAGGCCGCGTTGCCGGCGCACCCGATCACCACCCAATACCGCGAGACCGACTGGGCCTTCGTCAC
CCGCCTGCTGGCCGAGGCCGGCCTGGCCTGGCGCTACGCGCACGCGCAGGACGCCGACAGCCAGGCCACC
GCGGCCACGCTGGTGATCTTCGACCCGCAGGCGCAGGCGCCGGACAGCGGCACGATCCGCTTCCACCGCA
GCGACCTGGCCGAGGCCGACGATGCGATCGGCGCCTTCGGCGAGCGCCGCGGCGTCGTGCCCACCGCCAG
CACGGTGACCAGCTGGCACAGCGAGCAAGTGCGCGCGGTCGGCGCGCAGGCCCAGGCCGAGGCCGGCGCG
CTGCCGCCGCTGGAGGTCTACGTGCAGCCGCGCGCCGGGCGTTTCGCCCAGGAAGCGACCGCGCAGGATC
AGGCGCAGGCGCGGCTGGACGCGCTGCGCGTGCCGCACACGCTGCACGCCGGGGCCGGCAGCGCCCGCGT
GCTGGCGGCCGGGGCGGCGTTCACCTTGCGCCAGCACGCCCAGCACGACGGCCAGCGTTTCGTTCCGGTG
GCGATCGAGCACGTGGCGGTGAACAACCTGGGCCAGGGCATCGTCGCCCTGCTGGACGCGCCGGAGCTGG
AGCACGGCAGCTACCGCAACCGCTTCCTGGCGGTGCCGGCGGCCACGCCGCTGCGCGCGCTGCCGCAGGA
CCGCCCGCGCATGCCCGGGCCGCAGAGCGCGCGCGTGGTCGGCGTGGCCGACGCGGCGCTGAGCCCGAGC
CGCGACCACCAGGTGCGGATCCAGTTCCCGTGGCAGCGCGGCGACCAGCCCGCCCCGGGCGGGTTGACCG
ACAGCGCCAGCACCGCGCCCGGCCACGCGCCGGGCGACCAGCGCGCCGGCACCTGGGTGCCGGTGGCCGA
GTGGGTGGCCGGCCCGAACTGGGGCAGCCACTTCCTGCCGCGCATCGGCAGCGAAGTGCTGGTGGAGTTC
CTGCACGGGGACATCGATCAGCCGCGCATCACCGGCCAGTTGTACAACGGCGAGCTCGCCCCACCCTTCG
GCGGCGGCCTGGACGCGCATGCCAGCCACCCCGGCACGCTCAGCGGCCTGCACACCCAGTCCCACGACGG
CAGCGGCACCCAGCAATGGCTGCTGGACGACACCCCCGGCCAGCTGCGCACGCGCCTGCACACCTCGCTG
GCCGACACCCGGCTGGAACTGGGCTACCTGGTCCAGCACAGCGACACCGCCCGCGGCGCGCTGCGCGGCC
AGGGCTTCGAACTGGCCTCCCAGGGCTGGGGCAACGTGCATGCCGCGCAAGGCCTGCTGCTGTCCAGCAG
CGCCCGCGGCCAGGGCGCCTCGACCGCATTGGACGTGGCCGAGGCGGTGGCCCAGTTGCACGGCGCCCAA
CGCACCGCTCAGGCGCTGCACGCCACCCTGACCCAGCAACAGGTGCCCGGCCTGGACGCCCATCCCAGCG
TGACCCGGCTGCGCGAGGCCATCGACCCGCAAGCGCAGGGCAAGTACACCGCTGCGGTCGGCGGCCAGGC
GGCGACCAAGCCGGCCGACGGCGGCCGCGACGGCCAGGCACCGGTGGAACGCTTCGCCCAGGCGCGCCTG
CTCGGCGAGTCGCCGGACCACATCGCCTGGACCACCCCGGCCAGCGCGGTGGCCTATGCCGGGCAGGCCC
TGCAATTGACCGTGCAGCAGGATGCGCAGCTGAGCGCCGGGCAGACCCTGTCGGCGGTGTCCGGCCAGCA
CACCGCGCTGTTCGCCCAACGCGGACCGATCAAACTCATCGCCGCCGCCGGCCCGGTGAGCCTGCAGGCG
CATACCGGCGCGCTGGAACTGCTGGCCGACCAGGCGGTGACCGTCACCGCCACCGACACCGACACCCGCG
CTAGCTGTTGA

Protein ID: 84624961
SecReT6 ID117
T6SS typei4b
Gene symbol-
Locus tagXOO_3304
StrainXanthomonas oryzae pv. oryzae MAFF 311018
Repliconchromosome [GenBank: NC_007705] [Browse all T6SS(s) in this replicon]
Location [Strand]3762012..3764681 [-]
ProductVGR-like protein
NoteTssI
UniProt IDQ2P068
KEGG IDxom:XOO_3304
PDB IDNA
Domain hit(s) vs Pfam Phage_GPD [PF05954], Evalue: 1.00E-37, Aligned region: 78..303
Phage_GPD [PF05954], Evalue: 1.00E-37, Aligned region: 761..847
DUF2345 [PF10106], Evalue: 3.80E-37, Aligned region: 697..855
T6SS_Vgr [PF13296], Evalue: 2.80E-34, Aligned region: 532..638
T6SS_Vgr [PF13296], Evalue: 2.80E-34, Aligned region: 797..819
Phage_base_V [PF04717], Evalue: 1.80E-24, Aligned region: 375..472
YiaAB [PF05360], Evalue: 0.00066, Aligned region: 18..38
YiaAB [PF05360], Evalue: 0.00066, Aligned region: 57..79
Protein Sequence: 889 a.a.     [Download]
>gi|84624961|ref|YP_452333.1| VGR-like protein [Xanthomonas oryzae pv. oryzae MAFF 311018]
MRTRIANHSSVAFVGALWVGLLLFGVFAAVSVQKSVRDRVDGIGVTAIHHGEAGCSVVAALSLLTVGLCN
ATPPLSAKIVEAVFADYAPMASWQWSEETSAFLAQARPRSYCVQYRESDLDFVQRLLAEEGLGWRLQEAD
ASPGGHQLVVFADSAAQPQDPSSAQGGGLRYHRSDATEAADSVLAIGATRRLGSGRLTVLSEDFKTRQAR
SAQLPLHGGGRQSLREVYEPVGMDAFASAQAADRSAELMAQAHEAQWSPWQGRSTVRTLRAGTWFTLTQS
PQQGQAPPAQLLLTRVWHAGINNLPVDVRAAVQSQLGAAPAWPDASAVAARSTWAQAEAVGYGNAFEAVD
RQQPWRPVLADGTGARLHPRPTAPGYQSAIVVGADGSTGGSQEVHADALGRIRVRFHFQHAASAPAAQDS
TWLRVAQRYAGPGVGSQFLPRIGQEVLVGFLEGDIDRPVVLGALYNGKGEAGVPATPGGTSAEADTGLYA
KAGDGRPSAQGNLAGGHAPAWHGAGGGADNHRNATALWGVQSKEWGGAGHSRLVFDDSDQQLRLQLATTQ
AATQLNLGHLIHQADNYRGSFRGEGFELRTDAWGAVRASSGLWLSSYGRSGGPAGEATQPSALLSQLQTL
GKTFSQAAGTHQTVKLAAHEGVGQANHSQLIAEQAPLPALLTSVKTTVPGTAYADAKGAAAERRASPGDD
RVPHTGDALLGLAAPAGIGVVAGQGLSWSVGETLTLASGAGSEAAIAGDARLHSGQAIGVLAAAVDGRQT
QANSLSLVSGEGALDVQAQSDDVRVQSKEGLKLISANADVALAAGKTLHLAVAGGASVTIEGGNITVACP
GTITVHASKKSFVGPVQHAYPLPAFAKSVCIPCLLQAMGKGHALSPVNG
 
Nucleotide Sequence: 2670 bp     [Download]
>gi|84621657|ref|NC_007705.1|:c3764681-3762012 Xanthomonas oryzae pv. oryzae MAFF 311018 chromosome, complete genome
ATGCGAACGCGTATTGCCAACCATTCGTCCGTGGCCTTCGTCGGCGCGTTGTGGGTGGGGCTGCTGCTGT
TCGGCGTATTCGCGGCGGTATCGGTACAGAAGAGCGTGCGCGATCGCGTCGACGGCATCGGCGTGACGGC
GATCCACCATGGAGAGGCCGGGTGTTCGGTCGTCGCCGCGCTGTCGCTGCTGACCGTCGGTCTGTGCAAC
GCGACGCCGCCTCTGAGCGCAAAAATCGTGGAAGCGGTGTTCGCCGACTACGCGCCGATGGCAAGCTGGC
AGTGGAGCGAGGAGACGAGCGCGTTCCTGGCCCAGGCGCGGCCGCGCAGCTACTGCGTGCAGTACCGCGA
GAGCGACCTGGATTTCGTGCAGCGGCTGCTGGCCGAGGAAGGCCTGGGCTGGCGGCTGCAGGAGGCGGAC
GCGTCGCCCGGCGGGCACCAGCTGGTGGTGTTCGCCGACAGCGCCGCGCAACCGCAGGACCCCAGTTCGG
CGCAGGGCGGGGGGCTGCGCTACCACCGCAGCGACGCCACCGAGGCGGCCGACAGCGTGCTGGCGATCGG
CGCCACCCGGCGGCTGGGCAGCGGCCGGCTGACGGTGCTCAGCGAAGACTTCAAGACGCGTCAGGCGCGC
AGCGCGCAGTTGCCGTTGCACGGCGGCGGCAGGCAGTCGCTGCGCGAGGTGTACGAGCCGGTGGGGATGG
ACGCCTTCGCCAGCGCGCAGGCAGCAGACCGCTCTGCGGAGTTGATGGCGCAGGCGCACGAGGCGCAGTG
GTCACCGTGGCAGGGCCGCAGCACGGTGCGCACGCTGCGCGCCGGCACCTGGTTCACGCTGACCCAGTCA
CCGCAGCAGGGCCAGGCGCCGCCGGCGCAGCTGTTGCTGACGCGGGTGTGGCATGCGGGTATCAACAACT
TGCCGGTGGACGTGCGCGCGGCGGTGCAGTCGCAGTTGGGGGCCGCGCCGGCGTGGCCGGATGCCAGCGC
GGTGGCCGCACGCAGCACCTGGGCGCAGGCCGAGGCGGTGGGCTACGGCAACGCCTTCGAGGCGGTGGAC
CGGCAGCAGCCGTGGCGGCCGGTGCTGGCCGACGGCACCGGGGCGCGGCTGCACCCGCGGCCGACCGCGC
CGGGCTACCAGAGCGCCATCGTGGTCGGTGCCGATGGCAGCACCGGCGGCAGCCAGGAGGTCCATGCCGA
CGCGCTGGGCCGGATCCGGGTCAGGTTCCACTTCCAGCACGCCGCGTCGGCCCCGGCGGCGCAGGACAGC
ACGTGGCTGCGGGTGGCGCAGCGCTACGCCGGCCCGGGCGTGGGCAGCCAGTTCCTGCCGCGCATCGGCC
AGGAAGTGCTGGTGGGCTTCCTGGAGGGGGACATCGACCGTCCGGTGGTGCTGGGGGCGCTGTACAACGG
CAAGGGCGAAGCCGGCGTTCCCGCCACCCCCGGCGGCACCAGCGCCGAGGCCGACACCGGCCTGTACGCC
AAGGCCGGCGACGGCAGACCCAGCGCGCAGGGCAACCTGGCCGGCGGCCATGCCCCGGCCTGGCACGGCG
CCGGCGGCGGCGCGGACAACCACCGCAACGCCACCGCGCTGTGGGGCGTGCAATCCAAGGAATGGGGCGG
CGCTGGCCACAGCCGGCTGGTGTTCGACGACAGCGACCAGCAATTGCGCTTGCAACTTGCGACCACCCAG
GCAGCCACGCAACTGAACCTGGGGCACCTGATCCACCAGGCGGACAACTACCGCGGCAGCTTCCGCGGGG
AAGGCTTCGAACTGCGCACCGACGCGTGGGGCGCGGTGCGGGCCAGCTCGGGGCTATGGCTGAGCAGCTA
CGGCCGCAGCGGCGGCCCGGCCGGCGAGGCGACCCAGCCCAGCGCATTGCTGAGCCAGCTGCAGACGCTG
GGCAAGACGTTCTCGCAGGCGGCGGGCACGCACCAGACGGTGAAGCTGGCCGCGCACGAAGGCGTGGGCC
AGGCGAACCACTCCCAGCTGATCGCCGAGCAGGCGCCGCTGCCGGCGCTGCTGACCAGCGTGAAGACCAC
GGTGCCGGGCACGGCCTACGCCGACGCCAAGGGCGCGGCGGCCGAGCGCCGCGCCAGCCCGGGCGACGAC
CGGGTGCCGCATACCGGCGATGCGCTGCTGGGCCTGGCCGCACCAGCGGGGATCGGCGTGGTGGCCGGCC
AGGGCCTGAGCTGGAGCGTGGGCGAGACGCTGACGCTGGCCAGCGGCGCGGGCAGCGAAGCGGCCATCGC
CGGCGACGCCCGGCTGCACAGCGGCCAGGCAATCGGCGTGCTGGCCGCGGCGGTGGACGGCCGGCAAACG
CAAGCCAACAGCCTGAGCCTCGTCAGCGGCGAAGGCGCGCTGGACGTGCAGGCGCAGTCGGACGACGTGC
GCGTACAGTCGAAAGAAGGGCTGAAGCTGATCAGCGCCAACGCCGACGTGGCCCTGGCGGCGGGCAAGAC
CCTCCACCTGGCGGTGGCCGGCGGGGCCAGCGTGACCATCGAAGGCGGCAACATCACCGTCGCCTGCCCC
GGCACCATCACCGTGCATGCGAGCAAGAAGTCGTTCGTGGGGCCGGTGCAGCATGCGTATCCGTTGCCCG
CGTTCGCAAAGTCGGTCTGCATCCCGTGCCTGTTGCAGGCCATGGGCAAGGGGCACGCGTTGTCCCCGGT
GAATGGGTGA

Protein ID: 84624971
SecReT6 ID117
T6SS typei4b
Gene symbol-
Locus tagXOO_3314
StrainXanthomonas oryzae pv. oryzae MAFF 311018
Repliconchromosome [GenBank: NC_007705] [Browse all T6SS(s) in this replicon]
Location [Strand]3774535..3777351 [-]
ProductVGR-like protein
NoteTssI
UniProt IDQ2P058
KEGG IDxom:XOO_3314
PDB IDNA
Domain hit(s) vs Pfam Phage_GPD [PF05954], Evalue: 1.50E-60, Aligned region: 40..354
Phage_GPD [PF05954], Evalue: 1.50E-60, Aligned region: 851..897
DUF2345 [PF10106], Evalue: 6.10E-37, Aligned region: 748..906
T6SS_Vgr [PF13296], Evalue: 8.40E-34, Aligned region: 583..689
T6SS_Vgr [PF13296], Evalue: 8.40E-34, Aligned region: 848..869
Phage_base_V [PF04717], Evalue: 6.50E-24, Aligned region: 49..64
Phage_base_V [PF04717], Evalue: 6.50E-24, Aligned region: 426..523
Protein Sequence: 938 a.a.     [Download]
>gi|84624971|ref|YP_452343.1| VGR-like protein [Xanthomonas oryzae pv. oryzae MAFF 311018]
MEALNALMFQGALLSDSGRLYRLQLPGGDVQVVERWSGSERLSGGFEWWVDVLSTQAGLPLEAWLGRRAT
LYSRLADGDESPRTGLIHDAYALGSDGGLARYRVGLVPWTWWLSQGRHSRVFQERTLVQIVEAVFADYAP
MASWQWSEETSAFLAQARPRSYCVQYRESDLDFVQRLLAEEGLGWRLQEAAPSPGGHQLVVFADSVAQPQ
DPSSAQGGGLRYHRSDATEAADSVLAIGATRRLGSGRLTVLSEDFKTRQARSAQLPLHGGGRQSLREVYE
PVGMDAFASAQAADRSAELMAQAHEAQWSPWQGRSTVRTLRAGTWFTLTQSPQQGQAPPAQLLLTRVWHA
GINNLPVDVRAAVQSQLGAAPAWPDASAVAARSTWAQAEAVGYGNAFEAVDRQQPWRPVLADGTGARLHP
RPTAPGYQSAIVVGADGSTGGSQEVHADALGRIRVRFHFQHAASAPAAQDSTWLRVAQRYAGPGVGSQFL
PRIGQEVLVGFLEGDIDRPVVLGALYNGKGEAGVPATPGGTSAEADTGLYAKAGDGRPSAQGNLAGGHAP
AWHGAGGGADNHRNATALWGVQSKEWGSAGHSRLVFDDSDQQLRLQLATTQAATQLNLGHLIHQADNYRG
SFRGEGFELRTDAWGAVRASSGLWLSSYGRSGGPAGEATQPSALLSQLQTLGKTFSQAAGTHQTVKLAAH
EGVGQANHSQLIAEQAPLPALLTSVKTTVPGTAYADAKGAAAERRASPGDDRVPHTGDALLGLAAPAGIG
VVAGQGLSWSVGETLTLASGAGSEAAIAGDARLHSGQAIGVLAAAVDGGQTQANSLSLVSGEGALDVQAQ
SDDVRVQSKEGLKLISANADVALAAGKTLHLAVAGGASVTIEGGNITVACPGTITVHASKKSFVGPVQQA
YPLPQFPRSSCKSCILDAARQGTPGVLV
 
Nucleotide Sequence: 2817 bp     [Download]
>gi|84621657|ref|NC_007705.1|:c3777351-3774535 Xanthomonas oryzae pv. oryzae MAFF 311018 chromosome, complete genome
ATGGAAGCACTGAATGCATTGATGTTTCAGGGGGCCTTGCTGTCCGACAGCGGTCGCCTATACCGCTTGC
AGCTGCCTGGCGGGGATGTCCAGGTGGTGGAGCGCTGGAGCGGGTCGGAACGGCTGAGCGGCGGTTTTGA
GTGGTGGGTGGACGTGCTGAGCACGCAGGCGGGCTTGCCGCTGGAGGCGTGGCTGGGGCGGCGCGCGACG
CTGTACAGCCGGCTGGCCGATGGCGATGAAAGCCCGCGCACGGGGCTGATCCACGACGCGTACGCACTGG
GCAGCGACGGCGGGCTGGCGCGCTACCGGGTAGGCTTGGTGCCGTGGACGTGGTGGTTGTCGCAGGGCCG
GCACAGCCGGGTATTCCAGGAACGCACGCTGGTGCAGATCGTGGAAGCGGTGTTCGCCGACTATGCGCCG
ATGGCAAGCTGGCAGTGGAGCGAGGAGACGAGCGCGTTCCTGGCCCAGGCGCGGCCGCGCAGCTACTGCG
TGCAGTACCGCGAGAGCGACCTGGATTTCGTGCAGCGGCTGCTGGCCGAGGAAGGCCTGGGCTGGCGGCT
GCAGGAGGCGGCCCCGTCGCCCGGCGGGCACCAGCTGGTGGTGTTCGCCGACAGCGTCGCGCAACCGCAG
GACCCCAGTTCGGCGCAGGGCGGCGGGCTGCGCTACCACCGCAGCGACGCCACCGAGGCGGCCGACAGCG
TGCTGGCGATCGGCGCCACCCGGCGGCTGGGCAGCGGCCGGCTGACGGTGCTCAGCGAAGACTTCAAGAC
GCGTCAGGCGCGCAGCGCGCAGTTGCCGTTGCACGGCGGCGGCAGGCAGTCGCTGCGCGAGGTGTACGAG
CCGGTGGGGATGGACGCCTTCGCCAGCGCGCAGGCAGCAGACCGCTCTGCGGAGTTGATGGCGCAGGCGC
ACGAGGCGCAGTGGTCACCGTGGCAGGGCCGCAGCACGGTGCGCACGCTGCGCGCCGGCACCTGGTTCAC
GCTGACCCAGTCACCGCAGCAGGGCCAGGCACCGCCGGCGCAGCTGTTGCTGACGCGGGTGTGGCATGCG
GGTATCAACAACTTGCCGGTGGACGTGCGCGCGGCGGTGCAGTCGCAGTTGGGGGCCGCGCCGGCGTGGC
CGGATGCCAGCGCGGTGGCCGCACGCAGCACCTGGGCGCAGGCCGAGGCGGTGGGCTACGGCAACGCCTT
CGAGGCGGTGGACCGGCAGCAGCCGTGGCGGCCGGTGCTGGCCGACGGCACCGGGGCGCGGCTGCACCCG
CGGCCGACCGCGCCGGGCTACCAGAGCGCCATCGTGGTCGGTGCCGATGGCAGCACCGGCGGCAGCCAGG
AGGTCCATGCCGACGCGCTGGGCCGGATCCGGGTCAGGTTCCACTTCCAGCACGCCGCGTCGGCCCCGGC
GGCGCAGGACAGCACGTGGCTGCGGGTGGCGCAGCGCTACGCCGGCCCGGGCGTGGGCAGCCAGTTCCTG
CCGCGCATCGGCCAGGAAGTGCTGGTGGGCTTCCTGGAGGGGGACATCGACCGTCCGGTGGTGCTGGGTG
CGCTGTACAACGGCAAGGGCGAAGCCGGCGTTCCCGCCACCCCCGGCGGCACCAGCGCCGAGGCCGACAC
CGGCCTGTACGCCAAGGCCGGCGACGGTAGACCCAGCGCGCAGGGCAACCTGGCCGGCGGCCATGCCCCG
GCCTGGCACGGCGCCGGCGGCGGCGCGGACAACCACCGCAACGCCACCGCGCTGTGGGGCGTGCAATCCA
AGGAATGGGGCAGCGCTGGCCACAGCCGGCTGGTGTTCGACGACAGCGACCAGCAACTGCGCTTGCAGCT
GGCCACGACCCAGGCAGCCACGCAACTGAACCTGGGGCACCTGATCCACCAGGCCGACAACTACCGCGGC
AGCTTCCGCGGGGAAGGCTTCGAACTGCGCACCGACGCGTGGGGCGCGGTGCGTGCCAGCTCGGGGCTAT
GGCTGAGCAGCTACGGCCGCAGCGGCGGCCCGGCCGGCGAGGCGACCCAGCCCAGCGCATTGCTGAGCCA
GCTGCAGACGCTGGGCAAGACGTTCTCGCAGGCGGCGGGCACGCACCAGACGGTGAAGCTGGCCGCGCAC
GAAGGCGTGGGCCAGGCGAACCACTCCCAGCTGATCGCCGAGCAGGCACCGCTGCCGGCGCTGCTGACCA
GCGTGAAGACCACGGTGCCGGGCACGGCCTACGCCGACGCCAAGGGTGCGGCGGCCGAGCGCCGCGCCAG
CCCGGGCGACGACCGGGTGCCGCATACCGGCGATGCGCTGCTGGGCCTGGCCGCACCAGCGGGGATCGGC
GTGGTGGCCGGCCAGGGCCTGAGCTGGAGCGTGGGCGAGACGCTGACGCTGGCCAGCGGCGCGGGCAGCG
AAGCGGCCATCGCCGGCGACGCCCGGCTGCACAGCGGCCAGGCAATCGGCGTGCTGGCCGCGGCGGTGGA
CGGCGGGCAAACGCAGGCCAACAGCCTGAGCCTGGTCAGCGGCGAAGGCGCGCTGGACGTGCAGGCGCAG
TCGGACGACGTGCGCGTGCAGTCGAAAGAAGGGCTGAAGCTGATCAGCGCCAACGCCGACGTGGCACTGG
CGGCGGGCAAGACCCTCCACCTGGCGGTGGCCGGCGGGGCCAGCGTGACCATCGAAGGCGGCAACATCAC
CGTCGCCTGCCCCGGCACCATCACCGTGCATGCGAGCAAGAAGTCGTTTGTGGGGCCGGTGCAGCAGGCG
TATCCGTTGCCGCAGTTTCCACGCAGCAGTTGCAAGAGCTGCATCCTGGATGCAGCGCGCCAAGGAACCC
CGGGAGTGCTGGTGTGA