SecReT6
Protein ID: 84624945
SecReT6 ID117
T6SS typei4b
Gene symbol-
Locus tagXOO_3288
StrainXanthomonas oryzae pv. oryzae MAFF 311018
Repliconchromosome [GenBank: NC_007705] [Browse all T6SS(s) in this replicon]
Location [Strand]3738947..3741676 [-]
ProductClpA/B-type chaperone protein
NoteTssH
UniProt IDQ2P084
KEGG IDxom:XOO_3288
PDB IDNA
Domain hit(s) vs Pfam AAA_2 [PF07724], Evalue: 2.30E-44, Aligned region: 238..295
AAA_2 [PF07724], Evalue: 2.30E-44, Aligned region: 639..807
AAA [PF00004], Evalue: 4.20E-20, Aligned region: 239..352
AAA [PF00004], Evalue: 4.20E-20, Aligned region: 644..767
AAA_5 [PF07728], Evalue: 1.40E-14, Aligned region: 239..261
AAA_5 [PF07728], Evalue: 1.40E-14, Aligned region: 313..369
AAA_5 [PF07728], Evalue: 1.40E-14, Aligned region: 643..763
Clp_N [PF02861], Evalue: 2.70E-12, Aligned region: 23..74
Clp_N [PF02861], Evalue: 2.70E-12, Aligned region: 113..125
Clp_N [PF02861], Evalue: 2.70E-12, Aligned region: 405..418
ClpB_D2-small [PF10431], Evalue: 4.50E-12, Aligned region: 814..890
AAA_16 [PF13191], Evalue: 2.60E-11, Aligned region: 216..268
AAA_16 [PF13191], Evalue: 2.60E-11, Aligned region: 283..317
AAA_16 [PF13191], Evalue: 2.60E-11, Aligned region: 618..682
AAA_16 [PF13191], Evalue: 2.60E-11, Aligned region: 802..849
AAA_22 [PF13401], Evalue: 9.30E-08, Aligned region: 238..325
AAA_22 [PF13401], Evalue: 9.30E-08, Aligned region: 640..664
AAA_22 [PF13401], Evalue: 9.30E-08, Aligned region: 705..737
AAA_17 [PF13207], Evalue: 3.30E-07, Aligned region: 79..108
AAA_17 [PF13207], Evalue: 3.30E-07, Aligned region: 239..304
AAA_17 [PF13207], Evalue: 3.30E-07, Aligned region: 643..679
Sigma54_activat [PF00158], Evalue: 9.80E-07, Aligned region: 221..266
Sigma54_activat [PF00158], Evalue: 9.80E-07, Aligned region: 637..761
AAA_29 [PF13555], Evalue: 6.20E-05, Aligned region: 231..254
AAA_29 [PF13555], Evalue: 6.20E-05, Aligned region: 639..668
AAA_29 [PF13555], Evalue: 6.20E-05, Aligned region: 746..770
IstB_IS21 [PF01695], Evalue: 8.40E-05, Aligned region: 232..263
IstB_IS21 [PF01695], Evalue: 8.40E-05, Aligned region: 643..661
AAA_25 [PF13481], Evalue: 0.00011, Aligned region: 237..262
AAA_25 [PF13481], Evalue: 0.00011, Aligned region: 294..332
AAA_25 [PF13481], Evalue: 0.00011, Aligned region: 364..411
AAA_25 [PF13481], Evalue: 0.00011, Aligned region: 639..661
Arch_ATPase [PF01637], Evalue: 0.00014, Aligned region: 218..264
Arch_ATPase [PF01637], Evalue: 0.00014, Aligned region: 291..375
Arch_ATPase [PF01637], Evalue: 0.00014, Aligned region: 640..681
Arch_ATPase [PF01637], Evalue: 0.00014, Aligned region: 714..737
AAA_18 [PF13238], Evalue: 0.00017, Aligned region: 239..270
AAA_18 [PF13238], Evalue: 0.00017, Aligned region: 645..668
AAA_14 [PF13173], Evalue: 0.00019, Aligned region: 239..373
AAA_14 [PF13173], Evalue: 0.00019, Aligned region: 641..724
AAA_19 [PF13245], Evalue: 0.00021, Aligned region: 239..264
AAA_19 [PF13245], Evalue: 0.00021, Aligned region: 447..470
AAA_19 [PF13245], Evalue: 0.00021, Aligned region: 507..515
AAA_19 [PF13245], Evalue: 0.00021, Aligned region: 639..665
NACHT [PF05729], Evalue: 0.00056, Aligned region: 239..266
NACHT [PF05729], Evalue: 0.00056, Aligned region: 644..664
MobB [PF03205], Evalue: 0.00056, Aligned region: 240..265
MobB [PF03205], Evalue: 0.00056, Aligned region: 642..675
RNA_helicase [PF00910], Evalue: 0.001, Aligned region: 240..262
RNA_helicase [PF00910], Evalue: 0.001, Aligned region: 644..665
Zeta_toxin [PF06414], Evalue: 0.0011, Aligned region: 134..154
Zeta_toxin [PF06414], Evalue: 0.0011, Aligned region: 239..260
Zeta_toxin [PF06414], Evalue: 0.0011, Aligned region: 635..683
SRP54 [PF00448], Evalue: 0.0014, Aligned region: 239..263
SRP54 [PF00448], Evalue: 0.0014, Aligned region: 642..673
T2SE [PF00437], Evalue: 0.0031, Aligned region: 227..262
T2SE [PF00437], Evalue: 0.0031, Aligned region: 630..680
DUF815 [PF05673], Evalue: 0.0039, Aligned region: 230..314
DUF815 [PF05673], Evalue: 0.0039, Aligned region: 475..504
DUF815 [PF05673], Evalue: 0.0039, Aligned region: 598..680
DUF258 [PF03193], Evalue: 0.0046, Aligned region: 217..258
DUF258 [PF03193], Evalue: 0.0046, Aligned region: 638..655
DUF2075 [PF09848], Evalue: 0.0089, Aligned region: 239..341
Protein Sequence: 909 a.a.     [Download]
>gi|84624945|ref|YP_452317.1| ClpA/B-type chaperone protein [Xanthomonas oryzae pv. oryzae MAFF 311018]
MSINLKTLISKLDDTCRQAAERAANLCMARGNYEVDLEHLFLALLEQPQSDFVLIARRCGISPETLERDL
SEEVGRFKAGNTRTPVFSQHLPTLFEHAWLIASLDSETTRIRSGHLLLALLTEPDLSQLAYRGSKQFVKI
KLDALKHDFARLTEGSQEAGQSLRFADAGQADVGGDPVDGLAGAPDGKGGLTKTPALDQFTTNLVQRARD
AQIDPVIGRDGEIRQVIDILMRRRQNNPILTGEAGVGKTAVVEGLARRIAEKDVPDVLQGVELHVLDMGL
LQAGASVKGEFENRLKNVIDEVKKSPHPIILFIDEAHTMIGAGGTAGQNDAANLLKPALARGELRTIAAT
TWSEYKKYFEKDAALARRFQVVKVEEPSETLAAAMLRGMVPLMEKHFGIRVMDEAVTEAVRLSHRYISGR
QLPDKAVSVLDTACAKVALGQSATPAIIEDTRKHLDRLAAELAALNRETSGGARHHDARVAELLQAQESA
RKVLADNQTRLVRERELAERIVALRAQLEAAPAAHEPAAAAKPARGAAKQATAAASPQHAQLDALLAELG
ELQGETPMVPLQVDGGVVAEIVSAWTGVPLGRMVKDEIRTVRNLDSLLGERVIGQDHALAAIAQRVRTAT
AKLEDPNKPRGVFLFVGPSGVGKTETALALADILYGGERKLITINMSEYQEAHSVSGLKGSPPGYVGYGE
GGVLTEAVRRNPYSVVLLDEVEKAHPDVLEMFFQVFDKGVMDDAEGREIDFRNTLIILTSNVGSSQIMQA
CLNKPAEEIPAADALAEALRPILMRSFKPAFLGRLKVVPYYPISDDVLAQIIALKLGRIRDRLAANHKAA
FHWDQSLVEAVLARCTEVDSGARNVDHILNGTLLPEIAESVLAAMAEGGNINAIKVGAGKNGAFKYKLS
 
Nucleotide Sequence: 2730 bp     [Download]
>gi|84621657|ref|NC_007705.1|:c3741676-3738947 Xanthomonas oryzae pv. oryzae MAFF 311018 chromosome, complete genome
ATGAGCATCAATCTCAAGACCCTGATCAGCAAACTCGACGACACCTGCCGGCAGGCGGCCGAGCGCGCGG
CCAATCTGTGCATGGCGCGCGGCAACTACGAAGTCGACCTGGAGCATCTGTTCCTGGCGCTGCTGGAGCA
ACCGCAAAGCGATTTCGTGCTGATCGCGCGCCGCTGCGGCATTTCGCCGGAGACGCTGGAACGCGATCTC
AGCGAGGAGGTCGGCCGCTTCAAGGCCGGCAATACGCGCACGCCGGTATTTTCCCAGCACCTGCCCACGC
TGTTCGAGCACGCCTGGCTGATCGCCTCGCTGGATTCGGAAACCACGCGCATCCGCAGCGGTCATCTGCT
GCTGGCGCTGCTGACCGAGCCAGACCTGTCGCAGCTGGCCTACCGCGGTTCCAAGCAGTTCGTGAAGATC
AAGCTCGACGCGCTAAAGCACGACTTCGCCCGCCTCACCGAAGGCTCGCAGGAAGCCGGGCAAAGCCTGC
GTTTCGCCGATGCCGGCCAGGCCGACGTCGGCGGCGACCCGGTCGATGGCCTCGCCGGCGCGCCGGACGG
CAAGGGCGGCCTGACCAAGACCCCGGCGCTGGACCAGTTCACCACCAACCTCGTCCAGCGCGCCCGCGAT
GCGCAGATCGACCCGGTGATCGGCCGCGACGGCGAGATCCGCCAGGTGATCGACATCCTGATGCGGCGGC
GCCAGAACAATCCGATCCTCACCGGCGAAGCCGGCGTCGGCAAGACCGCGGTCGTCGAGGGGCTGGCCCG
GCGCATTGCCGAGAAGGACGTGCCGGACGTGTTGCAGGGGGTGGAACTGCATGTGCTGGACATGGGCTTG
CTGCAGGCCGGCGCCAGCGTCAAGGGCGAGTTCGAGAACCGGCTGAAGAACGTCATCGACGAGGTCAAGA
AGAGCCCGCATCCGATCATCCTGTTCATCGACGAGGCGCACACGATGATCGGCGCCGGCGGGACCGCCGG
CCAGAACGACGCGGCGAACCTGCTCAAGCCGGCGCTGGCGCGCGGCGAGCTGCGCACCATCGCGGCCACC
ACCTGGAGCGAATACAAGAAGTACTTCGAGAAGGACGCGGCGCTGGCACGGCGCTTCCAGGTGGTCAAGG
TCGAGGAGCCGAGCGAGACGCTGGCCGCGGCGATGCTGCGCGGCATGGTGCCGCTGATGGAGAAGCACTT
CGGCATCCGGGTGATGGACGAGGCGGTCACCGAGGCGGTGCGCCTGTCGCACCGCTACATCAGCGGCCGC
CAGCTGCCGGACAAGGCGGTCAGCGTGCTCGATACCGCCTGCGCCAAGGTCGCGCTCGGGCAGAGCGCCA
CCCCGGCGATCATCGAAGACACGCGCAAGCACCTGGACCGGCTGGCCGCGGAGCTGGCCGCGTTGAACCG
CGAGACGTCCGGCGGCGCCCGCCACCACGACGCGCGCGTGGCCGAGCTACTGCAAGCGCAGGAAAGCGCA
CGCAAGGTGCTGGCCGACAACCAGACGCGGCTGGTGCGCGAGCGCGAACTGGCCGAGCGCATCGTCGCCC
TGCGCGCGCAGCTGGAAGCGGCGCCGGCGGCGCACGAACCCGCGGCCGCCGCCAAGCCGGCACGCGGCGC
GGCGAAGCAGGCCACCGCGGCGGCTTCGCCGCAGCACGCCCAGCTGGACGCGCTGCTCGCCGAGCTGGGC
GAGCTGCAGGGCGAAACCCCGATGGTGCCGCTGCAGGTCGACGGCGGCGTGGTCGCCGAGATCGTCTCGG
CCTGGACCGGGGTGCCGCTGGGGCGCATGGTCAAGGACGAGATCCGCACCGTGCGCAACCTCGACAGCCT
GCTCGGCGAGCGCGTCATCGGCCAGGACCATGCGCTGGCCGCGATTGCCCAGCGCGTGCGCACCGCCACC
GCCAAGCTGGAAGACCCGAACAAGCCCCGCGGCGTCTTCCTCTTCGTCGGCCCGTCCGGCGTCGGCAAGA
CCGAGACCGCGCTGGCGCTGGCCGACATCCTGTACGGCGGCGAGCGCAAGCTGATCACCATCAACATGAG
CGAGTACCAGGAAGCGCACAGCGTGTCCGGGCTGAAGGGCTCTCCGCCTGGCTACGTCGGCTATGGCGAG
GGCGGCGTGCTGACCGAGGCGGTGCGGCGCAACCCGTACAGTGTGGTGCTGCTGGACGAGGTGGAGAAAG
CACACCCGGACGTGCTGGAGATGTTCTTCCAAGTGTTCGACAAGGGCGTGATGGACGATGCCGAAGGCCG
CGAGATCGACTTCCGCAACACCTTGATCATCCTCACGTCCAATGTCGGTTCCTCGCAGATCATGCAGGCC
TGCCTGAACAAGCCGGCCGAAGAGATTCCGGCCGCCGACGCATTGGCCGAGGCGTTGCGCCCGATCCTGA
TGCGCAGCTTCAAGCCGGCCTTCCTCGGCCGGCTGAAGGTGGTGCCGTATTACCCGATCAGCGACGACGT
GCTGGCGCAGATCATCGCGCTCAAGCTCGGCCGCATCCGCGACCGCTTGGCGGCCAACCACAAGGCCGCC
TTCCACTGGGACCAGAGCCTGGTGGAGGCGGTGTTGGCGCGCTGTACGGAAGTGGATTCGGGCGCGCGCA
ACGTCGACCACATTCTGAATGGGACGCTGTTGCCGGAAATCGCCGAGAGCGTGCTCGCGGCGATGGCCGA
AGGCGGCAACATCAACGCCATCAAAGTAGGCGCCGGCAAGAACGGCGCGTTCAAATACAAGTTATCCTGA