SecReT6
Protein ID: 84624946
SecReT6 ID117
T6SS typei4b
Gene symbol-
Locus tagXOO_3289
StrainXanthomonas oryzae pv. oryzae MAFF 311018
Repliconchromosome [GenBank: NC_007705] [Browse all T6SS(s) in this replicon]
Location [Strand]3741762..3742853 [-]
Producthypothetical protein
NoteTssG
UniProt IDQ2P083
KEGG IDxom:XOO_3289
PDB IDNA
Domain hit(s) vs Pfam DUF1305 [PF06996], Evalue: 1.80E-92, Aligned region: 18..344
Protein Sequence: 363 a.a.     [Download]
>gi|84624946|ref|YP_452318.1| hypothetical protein XOO_3289 [Xanthomonas oryzae pv. oryzae MAFF 311018]
MLTAKRRIDPGIALQLLAEPHRFQFFQAMRILERVFQRQGVKAGQALPTRVRFHNSLSLAFPATELDPVG
QAYSQDGERLESDAALAFAIETESLGEVHLTPNFMGLLGTSGALPLHYTETLHERELYQRDRTPRAFLDM
FSNRAVALHYAAWKKHRLALQYELDRRERFLPLVLSLLGMGMPGLRDRMVDGGGDVFDQAVAYYAGAIRQ
RPISAKLLQRVLADYFKVPVELEQFVGAWYKVPAQQATRLGQANATLGSSALAGDRVWQRDLRMRLRFGP
LQREAFDQFLPGGSAAKALSKWLMLLTGGGLEYEVKLVLRAEDVRGSGVGEALGVRLGWDSYLCSRPQTQ
PRADTTYGLHTLQ
 
Nucleotide Sequence: 1092 bp     [Download]
>gi|84621657|ref|NC_007705.1|:c3742853-3741762 Xanthomonas oryzae pv. oryzae MAFF 311018 chromosome, complete genome
ATGCTTACCGCGAAGCGGCGAATCGATCCTGGCATAGCGCTGCAACTGCTGGCCGAGCCGCATCGCTTCC
AGTTTTTCCAGGCGATGCGGATTCTGGAGCGGGTGTTCCAGCGCCAGGGGGTCAAGGCCGGTCAGGCCCT
GCCCACACGCGTACGTTTTCACAACTCGCTGTCGTTGGCGTTTCCGGCGACCGAGCTGGACCCCGTCGGC
CAGGCCTATTCGCAGGACGGCGAGCGCCTGGAAAGCGATGCGGCGCTGGCGTTCGCGATCGAGACCGAGA
GCCTGGGCGAAGTGCATCTGACCCCGAACTTCATGGGGTTGCTGGGCACCTCCGGCGCATTGCCGCTGCA
CTACACCGAGACCCTGCACGAACGCGAGCTGTACCAGCGCGACCGTACCCCACGCGCGTTCCTGGACATG
TTCTCCAACCGCGCGGTGGCGCTGCACTACGCCGCGTGGAAGAAGCACCGGCTGGCGCTGCAGTATGAGC
TGGACCGGCGCGAACGCTTCCTGCCGCTGGTGCTGTCGCTGCTGGGCATGGGCATGCCGGGACTGCGCGA
TCGCATGGTCGACGGCGGCGGCGACGTCTTCGACCAGGCGGTGGCGTACTACGCCGGCGCCATCCGCCAG
CGGCCGATCTCGGCCAAGCTGCTGCAGCGCGTGCTGGCCGACTACTTCAAGGTGCCGGTGGAGCTGGAGC
AGTTCGTCGGCGCCTGGTACAAGGTGCCGGCGCAACAGGCCACGCGGCTGGGCCAGGCAAACGCCACACT
CGGGTCCAGTGCGCTGGCCGGCGACCGGGTGTGGCAGCGCGACCTGCGCATGCGCCTGCGCTTCGGTCCG
CTGCAGCGTGAGGCTTTCGACCAGTTCCTGCCCGGAGGCAGCGCCGCGAAGGCCTTGTCGAAATGGCTGA
TGCTGCTCACCGGCGGCGGGCTGGAATACGAGGTCAAGCTGGTGCTGCGCGCCGAGGACGTACGCGGCTC
CGGCGTCGGCGAAGCACTGGGCGTACGCCTGGGCTGGGACAGCTACCTATGCTCGCGCCCGCAGACCCAG
CCGCGCGCCGACACCACCTACGGTCTGCATACCCTTCAATAG