SecReT6
Protein ID: 84624947
SecReT6 ID117
T6SS typei4b
Gene symbol-
Locus tagXOO_3290
StrainXanthomonas oryzae pv. oryzae MAFF 311018
Repliconchromosome [GenBank: NC_007705] [Browse all T6SS(s) in this replicon]
Location [Strand]3742817..3744652 [-]
Producthypothetical protein
NoteTssF
UniProt IDQ2P082
KEGG IDxom:XOO_3290
PDB IDNA
Domain hit(s) vs Pfam DUF879 [PF05947], Evalue: 7.70E-207, Aligned region: 4..610
Protein Sequence: 611 a.a.     [Download]
>gi|84624947|ref|YP_452319.1| hypothetical protein XOO_3290 [Xanthomonas oryzae pv. oryzae MAFF 311018]
MQDLLPYYERELGYLRRYGREFAERYPKIAGRLQLSADGSQDPHVERLIEAFALMGARISKRIEDDYPEF
TDALLEVLYPHYLRPFPSCSIAYFDMEGVAAKLSAPIRVPRGSYLQSRPVRGINCRFRTAYDVVLVPVAV
KAASYRGVADAPMAVSLPPGTGAQISISFELLSDQASFAGLGTDALRFFVDGEPSFCSAMRDALALGVKA
AYVESDGSGRWRRLADTPLVPVGFADDESLIDFPARSHPAYRLLTELFGYPDKFGFFDLQLKPVTAGASR
WFTLHLVLHATPPDRAANQVLEELDCKNIRLGCTPVVNLFAQHGEPIRVTHRSVTYPVIADGRRAFAYEV
HSIDSVHRIRQTPQGELIQEFRPFYSLHHGEDPERAGQYWVARRDEDVARQSPGYETEVSFVDLEFNPTL
PQTDVVSVELTCSNRDLPSQLAYGIAGGDLSIEGGTPARAISLLRKPSRPLRFRHGRGAQWRLISHLSLN
QLSLTGSGLPALKEMLRLYDISGSSVSSRQIDGIVGIEQYPVTTWLSGKHFASVVRGLEVRLTISENHFV
GTGVAAFAHVLDHFFGLYVHANSFIQLVLISSDTGEELVRCLPRSGESILA
 
Nucleotide Sequence: 1836 bp     [Download]
>gi|84621657|ref|NC_007705.1|:c3744652-3742817 Xanthomonas oryzae pv. oryzae MAFF 311018 chromosome, complete genome
ATGCAAGACCTGCTTCCCTACTACGAACGCGAACTGGGCTATCTGCGTCGCTACGGGCGCGAGTTCGCCG
AGCGCTATCCCAAGATTGCCGGGCGCCTGCAGCTGTCGGCCGACGGCAGCCAGGATCCGCATGTCGAGCG
CCTGATCGAGGCGTTCGCGCTGATGGGCGCGCGCATCTCCAAGCGCATTGAGGACGACTACCCCGAGTTC
ACCGACGCGCTGCTGGAAGTGCTGTATCCGCACTATCTGCGGCCGTTTCCGTCCTGCTCCATCGCCTATT
TCGACATGGAAGGCGTGGCTGCCAAGCTCAGCGCGCCGATCCGCGTGCCGCGCGGCAGCTACTTGCAGTC
GCGCCCGGTGCGCGGGATCAATTGCCGGTTCCGCACCGCCTACGACGTGGTACTGGTGCCGGTGGCGGTG
AAGGCCGCCAGCTACCGCGGCGTGGCCGATGCGCCGATGGCGGTCAGCCTGCCGCCGGGCACCGGCGCAC
AGATCTCGATCAGCTTCGAGCTGTTGTCCGACCAGGCCTCGTTCGCTGGCCTGGGCACCGACGCGCTGCG
TTTCTTCGTCGACGGCGAGCCGTCGTTTTGCTCGGCGATGCGCGATGCGCTGGCGCTGGGGGTCAAGGCG
GCCTATGTCGAGTCCGACGGCAGCGGACGCTGGCGCCGGCTGGCGGACACCCCGCTGGTGCCAGTGGGAT
TCGCCGACGACGAATCGCTGATCGATTTCCCGGCGCGTTCGCACCCGGCCTACCGCCTGCTGACCGAGCT
GTTCGGCTACCCGGACAAGTTCGGCTTCTTCGATCTTCAGCTCAAGCCGGTGACCGCCGGCGCCAGCCGC
TGGTTCACGTTGCACCTGGTCCTACACGCGACGCCGCCCGATCGCGCCGCCAACCAAGTGCTCGAGGAGT
TGGATTGCAAGAACATCCGCCTGGGCTGCACCCCGGTGGTGAACCTGTTCGCGCAGCACGGCGAGCCGAT
CCGCGTCACCCATCGCAGCGTCACCTATCCGGTGATCGCCGACGGGCGCCGCGCCTTTGCCTACGAAGTG
CATTCGATCGATTCGGTACACCGTATCCGGCAGACTCCGCAGGGCGAGCTAATCCAGGAGTTCCGCCCGT
TCTATTCGCTGCACCATGGCGAAGACCCCGAGCGCGCCGGCCAGTATTGGGTGGCGCGGCGCGACGAGGA
TGTGGCGCGGCAGAGTCCCGGTTACGAAACCGAAGTGAGCTTCGTGGACCTGGAATTCAATCCGACCCTG
CCGCAGACCGATGTGGTCAGCGTCGAACTCACCTGCAGCAATCGCGATCTGCCCAGCCAGCTCGCCTATG
GCATCGCCGGAGGCGACCTGTCGATCGAGGGCGGAACGCCGGCGCGCGCGATCAGCCTGTTGCGCAAGCC
GAGCCGGCCACTGCGGTTCCGCCACGGGCGCGGCGCGCAATGGCGGCTGATCTCGCACCTGTCGTTGAAT
CAGCTGTCGCTGACCGGCAGCGGCTTGCCGGCGTTGAAGGAGATGCTGCGGCTGTACGACATCTCCGGCA
GCAGCGTGTCGTCGCGGCAGATCGACGGCATCGTCGGCATCGAGCAGTATCCGGTCACCACCTGGCTGTC
CGGCAAGCATTTCGCATCGGTGGTGCGCGGCCTGGAAGTGCGTTTGACCATCAGCGAAAACCATTTCGTC
GGGACCGGCGTGGCCGCGTTCGCGCATGTGCTCGACCACTTCTTCGGCCTCTACGTCCACGCCAACAGCT
TTATCCAGCTGGTGCTCATTTCCAGCGACACAGGGGAGGAACTCGTCCGATGCTTACCGCGAAGCGGCGA
ATCGATCCTGGCATAG