SecReT6
Protein ID: 84624948
SecReT6 ID117
T6SS typei4b
Gene symbol-
Locus tagXOO_3291
StrainXanthomonas oryzae pv. oryzae MAFF 311018
Repliconchromosome [GenBank: NC_007705] [Browse all T6SS(s) in this replicon]
Location [Strand]3744655..3745143 [-]
Producthypothetical protein
NoteTssE
UniProt IDQ2P081
KEGG IDxom:XOO_3291
PDB IDNA
Domain hit(s) vs Pfam GPW_gp25 [PF04965], Evalue: 7.00E-22, Aligned region: 31..138
Protein Sequence: 162 a.a.     [Download]
>gi|84624948|ref|YP_452320.1| hypothetical protein XOO_3291 [Xanthomonas oryzae pv. oryzae MAFF 311018]
MKGLEPSLLEKLFDDTPKSTGGSHVFKAISIDQYKESVARDLEGLLNTRSAFSEEGLTEFPNCKQSLLTY
GLGDFSAMSLANGYDRTMICRSLEQAIARHERRLRNVHVTLETAGQFGGGLHFTIHALLDMEPAREPVSF
DAMLQPSTLQYSVSRLRRQAAP
 
Nucleotide Sequence: 489 bp     [Download]
>gi|84621657|ref|NC_007705.1|:c3745143-3744655 Xanthomonas oryzae pv. oryzae MAFF 311018 chromosome, complete genome
ATGAAGGGACTCGAACCCAGTCTGTTGGAAAAATTGTTCGACGACACGCCCAAGTCCACGGGTGGCTCGC
ATGTGTTCAAGGCCATCTCCATCGACCAATACAAGGAATCGGTCGCTCGCGACCTGGAAGGCCTATTGAA
CACCCGTTCGGCCTTCAGCGAAGAAGGCCTCACCGAATTTCCCAATTGCAAGCAGTCGTTGCTGACCTAC
GGCCTCGGCGATTTTTCCGCGATGAGCCTGGCCAATGGCTACGACCGCACGATGATCTGCCGCTCGCTGG
AGCAGGCGATCGCGCGCCATGAGCGGCGCCTGCGCAACGTGCACGTGACGCTGGAAACCGCCGGCCAGTT
CGGCGGCGGCCTGCATTTCACCATCCATGCGTTGCTGGACATGGAGCCGGCGCGCGAGCCGGTGAGCTTC
GACGCCATGCTGCAACCGTCCACCCTGCAGTACTCGGTCAGCCGCCTGCGGCGCCAGGCAGCGCCCTGA