SecReT6
Protein ID: 84624949
SecReT6 ID117
T6SS typei4b
Gene symbol-
Locus tagXOO_3292
StrainXanthomonas oryzae pv. oryzae MAFF 311018
Repliconchromosome [GenBank: NC_007705] [Browse all T6SS(s) in this replicon]
Location [Strand]3745291..3745788 [-]
Producthypothetical protein
NoteTssD
UniProt IDQ2P080
KEGG IDxom:XOO_3292
PDB IDNA
Domain hit(s) vs Pfam DUF796 [PF05638], Evalue: 1.10E-40, Aligned region: 5..138
Protein Sequence: 165 a.a.     [Download]
>gi|84624949|ref|YP_452321.1| hypothetical protein XOO_3292 [Xanthomonas oryzae pv. oryzae MAFF 311018]
MQHAFLSIDTIKGESHDDKHTDWVEIKSFSQDLLQPRSATASTAGGQSAARVNLSPIEIVKSIDLSTTAL
NQACANGTTFPKARIEFMRADKDGNAINYYLVELMNVLVHRVTTTVDEDGMPQEVVQLSFGAIKWTYNQQ
KPEGGVGGKAVAQWSATKNIPNYTV
 
Nucleotide Sequence: 498 bp     [Download]
>gi|84621657|ref|NC_007705.1|:c3745788-3745291 Xanthomonas oryzae pv. oryzae MAFF 311018 chromosome, complete genome
ATGCAGCACGCGTTTCTTTCTATCGATACCATCAAGGGTGAATCGCACGACGACAAGCACACGGACTGGG
TGGAGATCAAGTCGTTCTCCCAGGACTTGTTGCAGCCGCGCTCGGCCACCGCATCCACCGCTGGCGGTCA
GTCGGCCGCTCGTGTAAACCTGTCGCCGATCGAGATCGTCAAGTCGATCGATCTGTCCACCACCGCGCTG
AATCAGGCGTGCGCCAACGGCACCACCTTCCCCAAAGCCCGCATCGAGTTCATGCGCGCCGACAAGGACG
GTAATGCCATCAACTACTACCTGGTTGAGTTGATGAACGTGCTGGTACACCGCGTCACCACGACGGTGGA
CGAGGACGGCATGCCGCAAGAAGTCGTCCAGCTGAGCTTCGGCGCGATCAAGTGGACCTACAACCAGCAG
AAGCCGGAAGGCGGAGTCGGCGGCAAGGCGGTTGCGCAGTGGAGTGCTACCAAGAACATTCCCAACTACA
CCGTTTGA