SecReT6
Protein ID: 84624950
SecReT6 ID117
T6SS typei4b
Gene symbol-
Locus tagXOO_3293
StrainXanthomonas oryzae pv. oryzae MAFF 311018
Repliconchromosome [GenBank: NC_007705] [Browse all T6SS(s) in this replicon]
Location [Strand]3745930..3747426 [-]
Producthypothetical protein
NoteTssC
UniProt IDQ2P079
KEGG IDxom:XOO_3293
PDB IDNA
Domain hit(s) vs Pfam DUF877 [PF05943], Evalue: 1.10E-194, Aligned region: 69..492
Protein Sequence: 498 a.a.     [Download]
>gi|84624950|ref|YP_452322.1| hypothetical protein XOO_3293 [Xanthomonas oryzae pv. oryzae MAFF 311018]
MVAEVSSATHNSAPAALAETGLLDQIVEQSKVAKSETEHQRAKDIISELAKEVLEGTVVVSDNLNLTLDA
RIAEIDRIISEQLSAVMHAPEFQKLESSWRGLHYMCEQTSTGVTMKIKVFNSPQRDLVRDFKSAIDFDQS
ALFKKVYEEEFGTFGGAPFGALVGDYYIGRQPEDMYFVEQMSHVAAAAHAPFISAASESMFGLETFTDLG
KPRDLAKVFDTVEYAKWKSFRESEDSRYVGLTMPRFLGRLPYNPKDGTTVEGFNFVEDVDAADHSKYLWC
NTAYAMATRLTKAFEDYGWCAAIRGVEGGGLVEDLPTHTFRTDDGEVALKCPTEIAITDRREKELSDLGF
IPLVHCKNTDYAAFFGAQSAQKPKKYNTDAANANAILSAQLQYMFAVSRIAHYLKAMMREKIGSFASARN
VEDFLNRWISQYVLLDDNAGQEAKAQYPLREASVQVSEVPGKPGVYRAVAFIRPHFQLDELSVSLRLVAE
LPAGTKKA
 
Nucleotide Sequence: 1497 bp     [Download]
>gi|84621657|ref|NC_007705.1|:c3747426-3745930 Xanthomonas oryzae pv. oryzae MAFF 311018 chromosome, complete genome
ATGGTCGCAGAGGTTTCGAGTGCCACCCACAATTCGGCGCCCGCCGCGCTGGCAGAAACAGGCTTGCTCG
ACCAGATCGTCGAGCAGAGCAAGGTCGCCAAATCGGAGACCGAGCACCAGCGTGCGAAGGACATCATCTC
CGAGCTGGCCAAGGAGGTGCTGGAAGGTACCGTCGTGGTGTCGGACAACCTCAATCTGACGCTGGACGCG
CGCATTGCCGAGATCGACCGGATCATCTCCGAGCAGCTGAGCGCGGTGATGCATGCGCCGGAGTTCCAGA
AGCTGGAGAGCAGCTGGCGCGGCCTGCACTACATGTGCGAGCAGACGTCCACCGGCGTGACGATGAAGAT
CAAGGTCTTCAACTCGCCCCAGCGGGATCTGGTGCGCGACTTCAAGTCGGCGATCGACTTCGATCAAAGC
GCGCTGTTCAAGAAGGTCTACGAGGAAGAGTTCGGCACCTTCGGCGGTGCGCCATTCGGCGCATTGGTCG
GCGACTACTACATCGGCCGCCAGCCGGAGGACATGTACTTCGTCGAGCAGATGTCGCATGTGGCCGCCGC
GGCGCACGCGCCCTTCATCTCTGCCGCGTCTGAATCGATGTTTGGTCTGGAAACCTTCACCGACCTGGGC
AAACCGCGCGATCTGGCCAAGGTGTTCGACACTGTCGAATACGCCAAGTGGAAGTCGTTCCGTGAGTCGG
AGGATAGCCGCTACGTCGGCCTGACCATGCCGCGTTTTCTCGGGCGGCTGCCGTACAACCCGAAGGACGG
CACTACGGTCGAAGGCTTCAACTTCGTCGAAGACGTCGACGCTGCCGACCATAGCAAGTATCTGTGGTGC
AACACCGCTTATGCGATGGCCACGCGCCTGACCAAGGCGTTCGAGGACTACGGTTGGTGCGCGGCGATCC
GCGGTGTGGAAGGCGGTGGCCTGGTCGAAGACCTGCCGACCCACACCTTCCGCACCGACGACGGCGAAGT
GGCGCTGAAGTGCCCGACCGAGATCGCGATCACCGACCGCCGCGAGAAGGAACTCAGCGACCTGGGCTTC
ATCCCGCTGGTACATTGCAAGAACACCGACTACGCGGCGTTCTTCGGTGCGCAGTCGGCGCAGAAGCCGA
AGAAGTACAACACCGATGCGGCCAATGCCAACGCGATCCTGTCGGCGCAGCTGCAGTACATGTTCGCCGT
GTCGCGTATCGCCCATTACCTCAAGGCGATGATGCGCGAGAAGATCGGCAGTTTCGCCTCGGCGCGTAAT
GTCGAGGACTTCCTGAACCGTTGGATCTCCCAGTACGTGTTGTTGGACGACAACGCCGGTCAGGAAGCAA
AGGCGCAATACCCCTTGCGGGAAGCGTCCGTACAAGTTTCGGAAGTGCCGGGGAAACCCGGTGTCTACCG
CGCGGTGGCCTTCATCAGGCCGCATTTCCAGCTCGATGAGCTGTCTGTTTCGTTGCGTCTGGTGGCCGAA
CTGCCGGCTGGTACCAAGAAGGCGTAG