SecReT6
Protein ID: 84624951
SecReT6 ID117
T6SS typei4b
Gene symbol-
Locus tagXOO_3294
StrainXanthomonas oryzae pv. oryzae MAFF 311018
Repliconchromosome [GenBank: NC_007705] [Browse all T6SS(s) in this replicon]
Location [Strand]3747430..3747930 [-]
Producthypothetical protein
NoteTssB
UniProt IDQ2P078
KEGG IDxom:XOO_3294
PDB IDNA
Domain hit(s) vs Pfam DUF770 [PF05591], Evalue: 1.30E-58, Aligned region: 11..164
Protein Sequence: 166 a.a.     [Download]
>gi|84624951|ref|YP_452323.1| hypothetical protein XOO_3294 [Xanthomonas oryzae pv. oryzae MAFF 311018]
MAKKESIQKRLQKIRPPRVQLTYDVEKGDAIEQKELPFVVGVLGDFSGNPEQPLAKVKDRKFVNVDLDNF
DEVMEGMAPRAVYRVPNKISDAGGEFGVELKFKSIDDFRPEAVVDQVEPLRKLLESRTKLADLRNKLAGN
EKLEDLLTDVLNNTEQLKKLGREKEK
 
Nucleotide Sequence: 501 bp     [Download]
>gi|84621657|ref|NC_007705.1|:c3747930-3747430 Xanthomonas oryzae pv. oryzae MAFF 311018 chromosome, complete genome
ATGGCTAAGAAGGAAAGCATCCAGAAACGTCTGCAGAAGATTCGGCCACCGCGCGTGCAGCTGACATACG
ACGTGGAAAAGGGTGACGCGATCGAACAGAAGGAGCTGCCGTTCGTGGTAGGCGTGCTTGGGGATTTCAG
CGGCAATCCCGAACAGCCCCTGGCCAAGGTCAAGGATCGCAAATTCGTCAACGTCGACCTCGACAACTTC
GACGAGGTGATGGAGGGAATGGCGCCGCGCGCGGTTTACCGCGTGCCGAACAAGATCAGCGATGCCGGCG
GCGAGTTCGGCGTCGAACTCAAGTTCAAGTCGATCGACGACTTCCGTCCGGAGGCTGTGGTCGATCAGGT
CGAACCGCTGCGCAAGCTGCTAGAATCGCGCACCAAGCTGGCAGACCTGCGCAACAAGCTGGCCGGCAAC
GAGAAGCTCGAAGACCTGCTAACGGACGTGTTGAACAACACCGAACAGCTGAAGAAGCTGGGTCGGGAAA
AGGAGAAGTAA