SecReT6
Protein ID: 84624953
SecReT6 ID117
T6SS typei4b
Gene symbol-
Locus tagXOO_3296
StrainXanthomonas oryzae pv. oryzae MAFF 311018
Repliconchromosome [GenBank: NC_007705] [Browse all T6SS(s) in this replicon]
Location [Strand]3748853..3749461 [+]
Producttransmembrane protein
NoteTssJ
UniProt IDQ2P076
KEGG IDxom:XOO_3296
PDB IDNA
Domain hit(s) vs Pfam T6SS-SciN [PF12790], Evalue: 3.00E-31, Aligned region: 18..174
Protein Sequence: 202 a.a.     [Download]
>gi|84624953|ref|YP_452325.1| transmembrane protein [Xanthomonas oryzae pv. oryzae MAFF 311018]
MNISAHRFNFLLVLIVAALALSGCASGGIGKAMDKTLQAVGIKEAKPEASPMIPLRLFAGSNLNAGSDTH
ATAAVVKIYHLRSAQRFEQAAFNAFLDQAGEQAALGADLLSVNEIVLTPSARQELNEQMSEGTTTLGVVG
LFRAPAEGRWRMAFDTRRKELPTQGITIGIHACALTTASPALVTRLAGDPSSLASVRCAAAR
 
Nucleotide Sequence: 609 bp     [Download]
>gi|84621657|ref|NC_007705.1|:3748853-3749461 Xanthomonas oryzae pv. oryzae MAFF 311018 chromosome, complete genome
ATGAACATATCCGCCCACCGTTTCAATTTTCTGTTGGTTCTTATTGTAGCCGCCCTAGCCCTGTCAGGCT
GCGCCAGCGGCGGCATCGGCAAGGCGATGGACAAGACCCTGCAGGCAGTGGGCATCAAGGAAGCAAAGCC
AGAGGCGTCTCCGATGATTCCCCTGCGGCTGTTTGCCGGCAGCAACCTGAATGCGGGCAGCGACACGCAC
GCCACCGCAGCGGTGGTCAAGATCTATCACCTGCGCAGCGCGCAACGCTTCGAGCAGGCCGCGTTCAACG
CGTTCCTCGATCAGGCCGGAGAGCAGGCGGCGCTGGGCGCGGACCTGCTGTCGGTCAACGAGATCGTTCT
GACGCCAAGCGCCCGCCAGGAACTGAACGAGCAGATGTCCGAAGGCACCACCACCCTGGGCGTGGTGGGC
TTGTTCCGCGCGCCGGCCGAGGGCCGCTGGCGCATGGCCTTCGATACGCGACGCAAGGAATTGCCGACCC
AGGGCATCACCATCGGCATTCACGCCTGCGCGCTGACCACCGCCAGCCCGGCGCTGGTCACCCGCCTGGC
GGGCGATCCCAGCAGCCTGGCGTCGGTGCGTTGCGCCGCTGCGCGCTAG