SecReT6
Protein ID: 84624954
SecReT6 ID117
T6SS typei4b
Gene symbol-
Locus tagXOO_3297
StrainXanthomonas oryzae pv. oryzae MAFF 311018
Repliconchromosome [GenBank: NC_007705] [Browse all T6SS(s) in this replicon]
Location [Strand]3749613..3750947 [+]
Producthypothetical protein
NoteTssK
UniProt IDQ2P075
KEGG IDxom:XOO_3297
PDB IDNA
Domain hit(s) vs Pfam DUF876 [PF05936], Evalue: 2.70E-138, Aligned region: 16..442
Protein Sequence: 444 a.a.     [Download]
>gi|84624954|ref|YP_452326.1| hypothetical protein XOO_3297 [Xanthomonas oryzae pv. oryzae MAFF 311018]
MSKVFWGEGLFLRPQHFQRQDTYHEARLQDLAQTLHPYGWGTRRIRFDPQSMASGSLRALALSVVFPDGE
SYDAPAHDALPDALSLNDLPAGIQTTTVYLALPLLRDDGGNCRDAEGSQLARYQQLNRPTSDLYTDAAQS
ELAYLSKAVKLLTDDTPRDPYVTVPVARVRRTPTGGFELDEDFIPSCAHIDASPTLYRELRGLLDSLQAK
VDALYGLHRQSSQHIIEFRSGDIASFWLLHTACSSFGALSHLFHHPQLHPERLYQELLRMAGALLTFSNA
YQLNDLPRYNHAAPEACFQRLFQIVRDLLDTVISARYFKIALTEVKPSFHLGRIDSQRIDENAAFYLSVS
ADMPGPELVQTVPVRFKIGAPDDVEKCVLSALPGVKLTHAAQVPAAIPVRPGSYYFALEARGPLYERMLK
AQSMMLYVPSGIDDLKMELVAVTS
 
Nucleotide Sequence: 1335 bp     [Download]
>gi|84621657|ref|NC_007705.1|:3749613-3750947 Xanthomonas oryzae pv. oryzae MAFF 311018 chromosome, complete genome
ATGTCGAAAGTATTTTGGGGCGAAGGTCTGTTTTTGCGGCCGCAGCATTTCCAGCGCCAGGACACCTACC
ACGAAGCAAGGCTGCAGGATCTGGCGCAGACGCTGCATCCCTATGGCTGGGGAACGCGCCGGATCCGTTT
CGATCCGCAGAGCATGGCTAGCGGCAGCTTGCGCGCGCTCGCCCTGTCGGTGGTCTTTCCCGATGGCGAA
TCGTACGACGCGCCGGCGCACGACGCGCTGCCCGATGCGCTGTCGCTGAATGACCTCCCCGCCGGCATCC
AGACCACCACGGTGTACCTGGCGCTGCCGTTGCTGCGCGACGACGGCGGCAACTGTCGCGATGCGGAGGG
TTCGCAACTGGCCCGCTACCAGCAGCTCAACCGGCCGACCAGCGACCTGTACACCGACGCGGCCCAATCG
GAACTGGCGTACCTGAGCAAGGCGGTGAAGCTGCTCACCGACGACACTCCGCGCGATCCGTACGTGACCG
TGCCGGTGGCGCGCGTGCGCCGTACCCCGACCGGCGGCTTCGAGCTGGACGAGGACTTCATCCCGTCATG
CGCGCACATCGACGCCTCGCCGACGCTGTATCGCGAACTGCGCGGCCTGCTCGACTCGCTGCAGGCCAAG
GTCGATGCGCTGTACGGGCTGCATCGGCAATCGTCGCAGCACATCATCGAATTCCGCTCCGGCGACATCG
CCTCGTTCTGGCTGCTGCATACCGCCTGTTCCTCGTTCGGCGCGCTGTCGCACCTGTTCCATCATCCGCA
GCTGCACCCGGAGCGCTTGTACCAGGAACTGCTGCGCATGGCCGGCGCGTTGCTGACGTTCTCCAACGCC
TACCAGCTCAACGACCTGCCCCGGTACAACCACGCGGCGCCGGAAGCCTGCTTCCAGCGCCTGTTCCAGA
TCGTGCGCGACCTGCTCGACACGGTGATCTCGGCGCGCTATTTCAAGATCGCGCTGACCGAGGTCAAGCC
GTCGTTCCACCTGGGCCGGATCGATTCGCAGCGGATCGACGAGAACGCCGCGTTCTACCTGAGCGTGTCG
GCCGACATGCCCGGGCCGGAACTGGTGCAGACGGTGCCGGTGCGGTTCAAGATCGGTGCGCCGGACGACG
TCGAGAAGTGCGTGCTGTCGGCCCTGCCGGGCGTGAAACTGACCCACGCCGCGCAGGTGCCGGCAGCGAT
CCCGGTCCGTCCCGGCAGCTACTATTTCGCCCTGGAAGCGCGCGGGCCGCTGTACGAGCGCATGCTCAAG
GCGCAGTCTATGATGCTCTATGTGCCGTCAGGCATTGATGACCTCAAGATGGAACTTGTCGCGGTAACCT
CATGA