SecReT6
Protein ID: 84624955
SecReT6 ID117
T6SS typei4b
Gene symbol-
Locus tagXOO_3298
StrainXanthomonas oryzae pv. oryzae MAFF 311018
Repliconchromosome [GenBank: NC_007705] [Browse all T6SS(s) in this replicon]
Location [Strand]3750947..3751735 [+]
Producttransmembrane protein
NoteTssL
UniProt IDQ2P074
KEGG IDxom:XOO_3298
PDB IDNA
Domain hit(s) vs Pfam DUF2077 [PF09850], Evalue: 1.10E-57, Aligned region: 32..233
Protein Sequence: 262 a.a.     [Download]
>gi|84624955|ref|YP_452327.1| transmembrane protein [Xanthomonas oryzae pv. oryzae MAFF 311018]
MNPLPPTPGPMPSLTAQAPHGLPSAHTSTPQSLLDLMADGFYLLLLLKRTQMPSDTESFVQSVQTFLDGV
ERGAVKLGIASEDIYAAKYAFCAAVDEAILSQPSALHETWERNPLQLRLFGEHLAGEHFFDRLEELRRQG
AVRLPSLEIYHYCLLLGFEGKYRLEGPEKLGYLTARLGDEIIYFKGKRSGFAPHWPPPDNVRHALRRVVP
LWLPAALVAGFGLLGFFGLRLSLDHQTEQRMAAYNQVVQMPQRTAHITITLP
 
Nucleotide Sequence: 789 bp     [Download]
>gi|84621657|ref|NC_007705.1|:3750947-3751735 Xanthomonas oryzae pv. oryzae MAFF 311018 chromosome, complete genome
ATGAACCCGCTGCCCCCCACCCCCGGCCCGATGCCGTCGCTGACCGCGCAGGCACCGCACGGCCTGCCGA
GCGCCCATACCTCCACGCCGCAGAGCCTGCTCGACCTGATGGCCGACGGCTTCTACCTGTTGCTGCTGCT
CAAGCGCACGCAGATGCCCAGCGACACCGAATCCTTCGTGCAGTCGGTGCAGACATTCCTCGATGGCGTG
GAACGCGGCGCAGTCAAGCTCGGCATCGCCTCCGAGGACATCTACGCGGCCAAATACGCGTTCTGCGCGG
CAGTAGACGAAGCGATCCTGTCGCAGCCCTCGGCACTGCACGAAACCTGGGAACGCAATCCGCTGCAACT
GCGCCTGTTCGGCGAACACCTGGCCGGCGAGCATTTCTTCGATCGCCTGGAAGAGCTGCGCCGCCAGGGC
GCCGTGCGCCTGCCCTCGCTGGAGATCTACCACTATTGCCTGCTGCTTGGCTTCGAAGGCAAGTATCGGC
TGGAAGGGCCGGAAAAGCTCGGCTACCTGACCGCGCGGCTGGGCGACGAGATCATCTATTTCAAGGGCAA
GCGCAGCGGTTTCGCACCGCATTGGCCGCCGCCGGACAACGTGCGCCATGCCTTGCGCCGTGTGGTGCCG
CTGTGGCTGCCGGCCGCGCTGGTGGCCGGCTTCGGCCTGCTCGGCTTCTTCGGTCTGCGCCTGTCTCTGG
ACCACCAGACCGAGCAGCGCATGGCCGCCTACAACCAGGTGGTGCAGATGCCGCAACGCACCGCGCACAT
TACAATCACTCTGCCGTGA