SecReT6
Protein ID: 84624956
SecReT6 ID117
T6SS typei4b
Gene symbol-
Locus tagXOO_3299
StrainXanthomonas oryzae pv. oryzae MAFF 311018
Repliconchromosome [GenBank: NC_007705] [Browse all T6SS(s) in this replicon]
Location [Strand]3751746..3754463 [+]
ProductVGR-like protein
NoteTssI
UniProt IDQ2P073
KEGG IDxom:XOO_3299
PDB IDNA
Domain hit(s) vs Pfam Phage_GPD [PF05954], Evalue: 5.10E-57, Aligned region: 41..342
Phage_GPD [PF05954], Evalue: 5.10E-57, Aligned region: 618..772
Phage_GPD [PF05954], Evalue: 5.10E-57, Aligned region: 785..817
DUF2345 [PF10106], Evalue: 4.20E-49, Aligned region: 233..286
DUF2345 [PF10106], Evalue: 4.20E-49, Aligned region: 580..612
DUF2345 [PF10106], Evalue: 4.20E-49, Aligned region: 667..819
T6SS_Vgr [PF13296], Evalue: 2.40E-30, Aligned region: 515..621
T6SS_Vgr [PF13296], Evalue: 2.40E-30, Aligned region: 698..718
Phage_base_V [PF04717], Evalue: 3.40E-16, Aligned region: 386..495
Protein Sequence: 905 a.a.     [Download]
>gi|84624956|ref|YP_452328.1| VGR-like protein [Xanthomonas oryzae pv. oryzae MAFF 311018]
MDIPTLAVALASLAQPSQHARLIQLRAPVEGLVVERFHGQEAVCGATVLQIACLATSAFLDAEALLEQPL
DLQLRQADGTQRHWQGLCTEVAQLGGDGGLARYRLTLAPWTALLELRRNALVFQDLDARAICERIFADYP
QAAFRFDVQAALPAHPITTQYRETDWAFVTRLLAEAGLAWRYAHAQDADSQATAATLVIFDPQAQVPDSG
TIRFHRSDLAEADDAIGAFGERRGVVPTASTVTSWHSEQVRAVGAQAQAEAGGLPPLEVYVQPRAGRFAQ
EATAQDQAQARLDALRVPHTLHAGAGSARVLAAGAAFTLRQHAQHDGQRFVPVAIEHVAVNNLGQGIVAL
LDAPELEHGSYRNRFLAVPAATPLRALPQDRPRMPGPQSARVVGVADAALSPSRDHQVRIQFPWQRGDQP
TPGGLTDSASTAPGHAPGDQRAGTWVPVAEWVAGPNWGSHFLPRIGSEVLVEFLHGDIDQPRITGQLYNG
EVAPPFGGGLDARASHPGTLSGLHTQSHDGSGTQQWLLDDTPGQLRTRLHTSLADTRLELGYLVQHSDTA
RGALRGQGFELASQGWGNVHAAQGLLLSSSARGQGASTALDVAEAVAQLHGAQRTAQALHATLTQQQVPG
LDAHPSVTQLREAIDPQAQGKYTAAVGGQAATKPADGGRDGQAPVERFAQARLLGESPDHIAWTTPASAV
AYAGQALQLTVQQDAQLSAGQTLSAVSGQHTALFAQRGPIKLIAAAGPVSLQAHTGALELLADQAVTVTA
TDTRIDVLAQHKIVLQAGQTRITLEGGDITFACPGQFTVKASTHPFLGGEMNVAPLSALPGSLISDFGYD
EQFRLVADDGETPLSRCRYRITGNNGDAWEGIADEDGLTERVFTLVPTKLDVEIIGSSDDTEVIT
 
Nucleotide Sequence: 2718 bp     [Download]
>gi|84621657|ref|NC_007705.1|:3751746-3754463 Xanthomonas oryzae pv. oryzae MAFF 311018 chromosome, complete genome
ATGGATATCCCGACACTGGCCGTCGCCCTGGCTAGTCTGGCGCAGCCGTCCCAACATGCCCGCCTGATCC
AACTGCGCGCCCCGGTCGAGGGGCTGGTGGTGGAACGCTTCCACGGGCAGGAGGCGGTGTGCGGCGCCAC
CGTGCTGCAGATCGCGTGCCTGGCCACCTCGGCGTTTCTCGATGCCGAGGCGCTGCTGGAGCAGCCACTG
GACCTGCAGCTGCGCCAGGCCGACGGCACGCAACGCCACTGGCAGGGCCTGTGCACCGAAGTGGCGCAAC
TGGGCGGCGACGGCGGCCTGGCCCGCTACCGGCTGACCCTGGCGCCGTGGACGGCGCTGCTGGAGCTGCG
GCGCAACGCACTGGTGTTCCAGGACCTGGACGCGCGCGCGATTTGCGAACGGATCTTCGCCGACTACCCG
CAGGCCGCGTTCCGCTTCGACGTGCAGGCCGCGTTGCCGGCGCACCCGATCACCACCCAATACCGCGAGA
CCGACTGGGCCTTCGTCACCCGCCTGCTGGCCGAGGCCGGCCTGGCCTGGCGCTACGCGCACGCGCAGGA
CGCCGACAGCCAGGCCACCGCGGCCACGCTGGTGATCTTCGACCCGCAGGCGCAGGTGCCGGACAGCGGC
ACGATCCGCTTCCACCGCAGCGACCTGGCCGAGGCCGACGATGCGATCGGCGCCTTCGGCGAGCGCCGCG
GCGTCGTGCCCACCGCCAGCACGGTGACCAGCTGGCACAGCGAACAAGTGCGCGCGGTCGGCGCGCAGGC
CCAGGCCGAGGCCGGCGGGCTGCCGCCGCTGGAGGTCTACGTGCAGCCGCGCGCCGGGCGTTTCGCCCAG
GAAGCGACCGCGCAGGATCAGGCGCAGGCGCGGCTGGACGCGCTGCGCGTGCCGCACACGCTGCACGCCG
GGGCCGGCAGCGCCCGCGTGCTGGCGGCCGGGGCGGCGTTCACCTTGCGCCAGCACGCCCAGCACGACGG
CCAGCGTTTCGTTCCGGTGGCGATCGAGCACGTGGCGGTGAACAACCTGGGCCAGGGCATCGTCGCCCTG
CTGGACGCGCCGGAGCTGGAGCACGGCAGCTACCGCAACCGCTTCCTGGCGGTGCCGGCGGCCACGCCGC
TGCGCGCGCTGCCGCAGGACCGCCCGCGCATGCCCGGGCCGCAGAGCGCGCGCGTGGTCGGCGTGGCCGA
CGCGGCGCTGAGCCCGAGCCGCGACCACCAGGTGCGGATCCAGTTCCCGTGGCAGCGCGGCGACCAGCCC
ACCCCGGGCGGGTTGACCGACAGCGCCAGCACCGCGCCCGGCCACGCGCCGGGCGACCAGCGCGCCGGCA
CCTGGGTGCCGGTGGCCGAGTGGGTGGCCGGCCCGAACTGGGGCAGCCACTTCCTGCCGCGCATCGGCAG
CGAAGTGCTGGTGGAGTTCCTGCACGGGGACATCGATCAGCCGCGCATCACCGGCCAGTTGTACAACGGC
GAGGTCGCCCCACCCTTCGGCGGCGGCCTGGACGCGCGTGCCAGCCATCCCGGCACGCTCAGCGGCCTGC
ACACCCAGTCCCACGACGGCAGCGGCACCCAGCAATGGCTGCTGGACGACACCCCCGGCCAGCTGCGCAC
GCGCCTGCACACCTCGCTGGCCGACACCCGGCTGGAACTGGGCTACCTGGTCCAGCACAGCGACACCGCC
CGCGGCGCGCTGCGCGGCCAGGGCTTCGAACTGGCCTCCCAGGGCTGGGGCAACGTGCATGCCGCGCAAG
GCCTGCTGCTGTCCAGCAGCGCCCGCGGCCAGGGCGCCTCGACCGCATTGGACGTGGCCGAGGCGGTGGC
CCAGTTGCACGGCGCCCAACGCACCGCTCAGGCGCTGCACGCCACCCTGACCCAGCAACAGGTGCCCGGC
CTGGACGCCCATCCCAGCGTGACCCAACTGCGCGAGGCCATCGACCCGCAGGCGCAGGGCAAGTACACCG
CTGCGGTCGGCGGCCAGGCGGCGACCAAGCCAGCCGACGGCGGCCGCGACGGCCAGGCACCGGTGGAACG
CTTCGCCCAGGCGCGCCTGCTCGGCGAGTCGCCGGACCACATCGCCTGGACCACCCCGGCCAGCGCGGTG
GCCTATGCCGGGCAGGCCCTGCAATTGACCGTGCAGCAGGATGCGCAGCTGAGCGCCGGGCAGACCCTGT
CGGCGGTGTCCGGCCAGCACACCGCGCTGTTCGCCCAACGCGGACCGATCAAACTCATCGCCGCCGCCGG
CCCGGTGAGCCTGCAGGCGCATACCGGCGCGCTGGAACTGCTGGCCGACCAGGCGGTGACCGTCACCGCC
ACCGACACCCGCATCGACGTGCTGGCGCAGCACAAGATCGTGCTGCAGGCCGGACAGACCCGCATCACCC
TGGAAGGCGGCGACATCACCTTCGCCTGCCCGGGGCAGTTCACGGTCAAGGCCAGCACGCATCCGTTCTT
GGGTGGGGAGATGAATGTAGCCCCGCTCTCTGCCTTACCAGGCTCACTGATATCAGACTTCGGCTACGAC
GAGCAATTCCGTCTTGTAGCTGACGACGGAGAAACTCCCCTTTCAAGATGTCGTTACAGGATCACGGGGA
ACAATGGAGACGCCTGGGAAGGGATTGCCGACGAGGACGGACTGACAGAAAGAGTCTTCACCTTAGTCCC
CACAAAACTCGATGTAGAAATAATTGGAAGTTCTGACGATACGGAGGTGATCACATGA